9DZY: Pre-Chi dynein

Cryo-EM structure of Pre-Chi dynein bound to Lis1. Determined by electron microscopy at 3.1 Å resolution. Released 9 Jul 2025.

Method: Electron microscopy
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 51,122
Mol. weight: 1205.37 kDa
Ligands: MG, ATP, ADP
Released: 9 Jul 2025

Explore 9DZY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9DZY contains 276 α-helices and 210 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 134 helices, 75 β-strands

Element	Residues	Length	Sheet
α-helix	1445-1472	28
β-strand	1474	1	41
β-strand	1476-1480	5	42
β-strand	1484-1488	5	42
α-helix	1490-1509	20
α-helix	1517-1552	36
α-helix	1562-1584	23
β-strand	1587	1	41
α-helix	1588-1592	5
α-helix	1597-1613	17
α-helix	1616-1625	10
α-helix	1627-1631	5
α-helix	1634-1642	9
α-helix	1654-1657	4
β-strand	1663-1666	4	43
β-strand	1672-1677	6	43
β-strand	1683-1691	9	43
α-helix	1698-1728	31
α-helix	1735-1744	10
α-helix	1747-1767	21
α-helix	1776-1797	22
α-helix	1802-1827	26
α-helix	1836-1839	4
β-strand	1844-1846	3	44
α-helix	1854-1856	3
β-strand	1857-1861	5	44
β-strand	1864-1867	4	44
α-helix	1878-1880	3
α-helix	1883-1897	15
β-strand	1901-1905	5	45
α-helix	1913-1923	11
β-strand	1927-1931	5	45
α-helix	1938-1951	14
β-strand	1954-1958	5	45
α-helix	1960-1962	3
α-helix	1965-1986	22
β-strand	1998-2001	4	46
β-strand	2004-2007	4	46
β-strand	2014-2018	5	45
α-helix	2030-2033	4
β-strand	2036-2040	5	45
α-helix	2046-2057	12
α-helix	2062-2079	18
α-helix	2090-2113	24
α-helix	2133-2145	13
α-helix	2154-2164	11
α-helix	2176-2188	13
α-helix	2201-2216	16
β-strand	2219-2223	5	47
α-helix	2230-2245	16
β-strand	2249-2254	6	47
α-helix	2261-2264	4
β-strand	2266-2268	3	48
β-strand	2275-2277	3	48
α-helix	2279-2289	11
β-strand	2298-2303	6	47
α-helix	2316-2319	4
β-strand	2324-2326	3	49
β-strand	2332-2334	3	49
α-helix	2335-2336	2
β-strand	2339-2345	7	47
α-helix	2353-2356	4
β-strand	2360-2363	4	47
α-helix	2371-2383	13
α-helix	2411-2427	17
α-helix	2433-2440	8
α-helix	2451-2475	25
α-helix	2483-2503	21
α-helix	2508-2521	14
β-strand	2537-2539	3	50
β-strand	2545-2547	3	50
α-helix	2549-2551	3
α-helix	2572-2586	15
β-strand	2591-2594	4	51
α-helix	2603-2609	7
β-strand	2615	1	52
β-strand	2618-2620	3	51
α-helix	2629-2638	10
β-strand	2639-2643	5	53
β-strand	2648-2652	5	53
β-strand	2658	1	52
β-strand	2659-2663	5	51
α-helix	2670-2672	3
α-helix	2678-2689	12
β-strand	2691-2694	4	53
β-strand	2699-2703	5	53
β-strand	2706-2712	7	51
α-helix	2722-2724	3
α-helix	2725-2728	4
α-helix	2732	1
β-strand	2733-2735	3	51
α-helix	2741-2755	15
α-helix	2760-2762	3
α-helix	2767-2783	17
α-helix	2796-2810	15
α-helix	2818-2833	16
α-helix	2840-2857	18
α-helix	2863-2866	4
β-strand	2873-2874	2	54
β-strand	2882-2883	2	54
α-helix	2886-2900	15
α-helix	2913-2927	15
β-strand	2933-2936	4	55
α-helix	2944-2954	11
α-helix	2956	1
β-strand	2957-2960	4	55
α-helix	2969-2984	16
β-strand	2990-2995	6	55
α-helix	2996-2998	3
α-helix	3002-3014	13
α-helix	3024-3040	17
α-helix	3048-3061	14
β-strand	3063-3068	6	55
α-helix	3072-3081	10
α-helix	3084-3087	4
β-strand	3090-3093	4	55
α-helix	3097-3098	2
α-helix	3099-3110	12
α-helix	3121-3123	3
α-helix	3139-3164	26
α-helix	3173-3252	80
α-helix	3436-3493	58
α-helix	3496-3516	21
α-helix	3522-3538	17
α-helix	3549-3553	5
α-helix	3556-3564	9
α-helix	3571-3581	11
α-helix	3586	1
β-strand	3587-3590	4	56
α-helix	3595-3603	9
α-helix	3608-3609	2
β-strand	3610-3613	4	56
α-helix	3619-3629	11
β-strand	3633-3636	4	56
α-helix	3638-3640	3
α-helix	3643-3645	3
α-helix	3646-3650	5
β-strand	3653-3654	2	57
β-strand	3661-3664	4	57
β-strand	3667-3670	4	57
α-helix	3671-3672	2
β-strand	3677-3681	5	56
α-helix	3690-3695	6
β-strand	3697-3700	4	56
α-helix	3705-3720	16
α-helix	3722-3754	33
α-helix	3764-3781	18
α-helix	3784-3817	34
α-helix	3818-3820	3
α-helix	3829-3840	12
α-helix	3852-3872	21
α-helix	3880-3894	15
α-helix	3902-3909	8
α-helix	3911-3913	3
α-helix	3914-3917	4
α-helix	3929-3938	10
α-helix	3948-3953	6
α-helix	3982-3996	15
α-helix	3998-4000	3
α-helix	4001-4013	13
α-helix	4018-4021	4
α-helix	4024-4025	2
α-helix	4027-4029	3
α-helix	4030-4034	5
β-strand	4041-4045	5	58
α-helix	4052-4061	10
β-strand	4066-4070	5	58
α-helix	4074-4090	17
β-strand	4093-4097	5	58
α-helix	4099-4101	3
α-helix	4103-4114	12
β-strand	4123-4129	7	58
α-helix	4136-4141	6
β-strand	4143-4144	2	58
β-strand	4147	1	58
α-helix	4153-4163	11
α-helix	4166-4169	4
α-helix	4175-4195	21
α-helix	4209-4226	18
α-helix	4240-4246	7
α-helix	4247-4251	5
α-helix	4259-4272	14
α-helix	4275-4278	4
β-strand	4283-4285	3	59
β-strand	4294-4295	2	59
α-helix	4302-4310	9
α-helix	4318-4320	3
α-helix	4327-4349	23
α-helix	4380-4388	9
α-helix	4392-4394	3
α-helix	4408-4438	31
α-helix	4446-4457	12
α-helix	4459-4461	3
α-helix	4475-4497	23
β-strand	4509-4510	2	60
α-helix	4517-4532	16
β-strand	4540-4544	5	60
β-strand	4558-4561	4	60
β-strand	4563-4566	4	61
β-strand	4569	1	62
β-strand	4575	1	63
β-strand	4576	1	62
β-strand	4583-4585	3	61
β-strand	4588-4593	6	60
β-strand	4604-4610	7	61
β-strand	4618-4625	8	61
β-strand	4626	1	63
α-helix	4632-4638	7
β-strand	4641-4643	3	61

Chain B: 137 helices, 75 β-strands

Element	Residues	Length	Sheet
α-helix	1445-1472	28
β-strand	1474	1	1
β-strand	1476-1480	5	2
β-strand	1484-1488	5	2
α-helix	1490-1509	20
α-helix	1517-1553	37
α-helix	1557-1560	4
α-helix	1562-1584	23
β-strand	1587	1	1
α-helix	1588-1593	6
α-helix	1597-1613	17
α-helix	1616-1625	10
α-helix	1627-1631	5
α-helix	1634-1642	9
α-helix	1651-1653	3
β-strand	1663-1666	4	3
β-strand	1672	1	4
β-strand	1673-1677	5	3
β-strand	1683-1685	3	3
β-strand	1691	1	4
α-helix	1698-1728	31
α-helix	1735-1744	10
α-helix	1747-1767	21
α-helix	1776-1797	22
α-helix	1802-1827	26
α-helix	1836-1839	4
β-strand	1843-1846	4	5
β-strand	1857-1861	5	5
β-strand	1864-1867	4	5
α-helix	1878-1880	3
α-helix	1883-1897	15
β-strand	1901-1905	5	6
α-helix	1912-1922	11
β-strand	1927-1931	5	6
α-helix	1938-1951	14
β-strand	1954-1958	5	6
α-helix	1960-1962	3
α-helix	1966-1986	21
β-strand	1998-2000	3	7
β-strand	2005-2007	3	7
β-strand	2014-2018	5	6
α-helix	2026-2029	4
α-helix	2030-2033	4
β-strand	2036-2040	5	6
α-helix	2046-2057	12
α-helix	2062-2079	18
α-helix	2081-2082	2
α-helix	2090-2113	24
α-helix	2133-2145	13
α-helix	2146-2148	3
α-helix	2154-2164	11
α-helix	2176-2188	13
α-helix	2201-2216	16
β-strand	2219-2223	5	8
α-helix	2230-2245	16
β-strand	2249-2254	6	8
α-helix	2261-2265	5
β-strand	2266-2268	3	9
β-strand	2275-2277	3	9
α-helix	2279-2289	11
β-strand	2298-2303	6	8
α-helix	2312-2319	8
β-strand	2324-2326	3	10
β-strand	2332-2334	3	10
α-helix	2335-2336	2
β-strand	2339-2345	7	8
α-helix	2353-2356	4
β-strand	2360-2363	4	8
α-helix	2371-2383	13
α-helix	2411-2427	17
α-helix	2431-2440	10
α-helix	2448-2449	2
α-helix	2451-2475	25
α-helix	2483-2503	21
α-helix	2508-2521	14
α-helix	2534-2536	3
β-strand	2537-2539	3	11
β-strand	2545-2547	3	11
α-helix	2572-2586	15
β-strand	2591-2594	4	12
α-helix	2603-2609	7
β-strand	2615-2620	6	12
α-helix	2629-2638	10
β-strand	2639-2644	6	13
β-strand	2647-2652	6	13
β-strand	2658-2663	6	12
α-helix	2670-2671	2
α-helix	2678-2689	12
β-strand	2691-2694	4	13
β-strand	2699-2703	5	13
β-strand	2706-2712	7	12
α-helix	2722-2724	3
α-helix	2725-2728	4
β-strand	2733-2735	3	12
α-helix	2740-2755	16
α-helix	2760-2762	3
α-helix	2767-2783	17
α-helix	2796-2810	15
α-helix	2818-2833	16
α-helix	2840-2857	18
α-helix	2863-2866	4
β-strand	2873-2874	2	14
β-strand	2882-2883	2	14
α-helix	2886-2903	18
α-helix	2913-2927	15
β-strand	2932-2936	5	15
α-helix	2943-2954	12
α-helix	2956	1
β-strand	2957-2959	3	15
α-helix	2969-2980	12
α-helix	2981-2985	5
β-strand	2990-2995	6	15
α-helix	3002-3014	13
α-helix	3024-3040	17
α-helix	3048-3061	14
β-strand	3062-3068	7	15
α-helix	3072-3081	10
α-helix	3083-3085	3
β-strand	3089-3093	5	15
α-helix	3097-3098	2
α-helix	3099-3109	11
α-helix	3110-3112	3
α-helix	3137	1
α-helix	3139-3164	26
α-helix	3173-3252	80
α-helix	3436-3516	81
α-helix	3522-3538	17
α-helix	3549-3553	5
α-helix	3556-3564	9
α-helix	3571-3581	11
α-helix	3586	1
β-strand	3587-3590	4	16
α-helix	3595-3603	9
β-strand	3610	1	16
β-strand	3613	1	17
α-helix	3620-3629	10
β-strand	3633-3635	3	16
β-strand	3636	1	17
α-helix	3638-3640	3
α-helix	3643-3645	3
α-helix	3646-3650	5
β-strand	3653-3654	2	18
β-strand	3661-3664	4	18
β-strand	3667-3670	4	18
β-strand	3677-3681	5	16
α-helix	3690-3695	6
β-strand	3697-3700	4	16
α-helix	3705-3720	16
α-helix	3722-3754	33
α-helix	3764-3817	54
α-helix	3819-3822	4
α-helix	3829-3840	12
α-helix	3852-3872	21
α-helix	3880-3894	15
α-helix	3902-3910	9
α-helix	3911-3913	3
α-helix	3929-3938	10
α-helix	3947-3953	7
α-helix	3982-3996	15
α-helix	3998-4000	3
α-helix	4001-4013	13
α-helix	4024-4025	2
α-helix	4027-4033	7
β-strand	4041-4045	5	19
α-helix	4052-4062	11
β-strand	4066-4070	5	19
α-helix	4074-4090	17
β-strand	4093-4097	5	19
α-helix	4099-4101	3
α-helix	4103-4115	13
β-strand	4124-4127	4	19
α-helix	4136-4141	6
β-strand	4145-4147	3	19
α-helix	4149-4150	2
α-helix	4152-4163	12
α-helix	4166-4169	4
α-helix	4171	1
α-helix	4175-4195	21
α-helix	4209-4226	18
α-helix	4235-4237	3
α-helix	4240-4246	7
α-helix	4247-4251	5
α-helix	4259-4272	14
α-helix	4275-4278	4
β-strand	4283-4288	6	20
β-strand	4292-4295	4	20
α-helix	4296-4297	2
α-helix	4302-4310	9
α-helix	4325-4328	4
α-helix	4329-4349	21
α-helix	4380-4390	11
α-helix	4391-4394	4
α-helix	4408-4438	31
α-helix	4443-4445	3
α-helix	4446-4457	12
α-helix	4459-4461	3
α-helix	4475-4497	23
β-strand	4509-4510	2	21
α-helix	4517-4532	16
β-strand	4540-4544	5	22
β-strand	4560-4561	2	21
β-strand	4564-4566	3	23
β-strand	4568-4570	3	23
β-strand	4574-4577	4	23
β-strand	4584	1	23
β-strand	4588	1	21
β-strand	4589-4593	5	22
β-strand	4604-4610	7	23
β-strand	4618-4626	9	23
α-helix	4627	1
α-helix	4632-4638	7
β-strand	4641-4643	3	23

Chain C: 3 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	96	1	33
β-strand	102-104	3	34
β-strand	114-116	3	35
β-strand	123-125	3	35
β-strand	131-136	6	35
β-strand	141-147	7	35
β-strand	153-158	6	36
β-strand	164-169	6	36
β-strand	173-178	6	36
β-strand	184-189	6	36
β-strand	195-200	6	37
β-strand	206-211	6	37
β-strand	216-220	5	37
β-strand	226-230	5	37
β-strand	237-242	6	38
β-strand	248-253	6	38
β-strand	258-262	5	38
β-strand	270-272	3	38
β-strand	279-284	6	39
α-helix	285-286	2
α-helix	287-289	3
α-helix	290-296	7
β-strand	310-315	6	39
β-strand	319-324	6	39
β-strand	329-335	7	39
β-strand	341-346	6	40
β-strand	353-357	5	40
β-strand	361-365	5	40
β-strand	375-377	3	40
β-strand	383-388	6	34
β-strand	394-399	6	34
β-strand	404-408	5	34
β-strand	409	1	33

Chain E: 2 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	96	1	24
β-strand	102-104	3	25
β-strand	111-116	6	26
β-strand	123-127	5	26
β-strand	132-136	5	26
β-strand	141-145	5	26
β-strand	153-158	6	27
β-strand	164-169	6	27
β-strand	174-178	5	27
β-strand	183-188	6	27
β-strand	195	1	28
β-strand	199-200	2	29
β-strand	206-208	3	29
β-strand	211	1	28
β-strand	216-220	5	29
β-strand	226-230	5	29
β-strand	237-242	6	30
β-strand	248-253	6	30
β-strand	258-262	5	30
β-strand	270-272	3	30
α-helix	287-289	3
α-helix	290-296	7
β-strand	321-322	2	31
β-strand	332-333	2	31
β-strand	341-346	6	32
β-strand	353-357	5	32
β-strand	361-366	6	32
β-strand	371-377	7	32
β-strand	383-388	6	25
β-strand	394-399	6	25
β-strand	404-408	5	25
β-strand	409	1	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytoplasmic dynein 1 heavy chain 1	A, B	protein	4843	Homo sapiens	Q14204
Platelet-activating factor acetylhydrolase IB subunit beta	C, E	protein	411	Homo sapiens	P43034 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9DZY_1 Cytoplasmic dynein 1 heavy chain 1 (chains A, B)
GDYDIPTTENLYFQGDKDCEMKRTTLDSPLGKLELSGCEQGLHRIIFLGKGTSAADAVEV
PAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVV
KFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPCHRVVQGDLDVGGYEGGLAVKE
WLLAHEGHRLGKPGLGGSSEPGGGGGEDGSAGLEVSAVQNVADVSVLQKHLRKLVPLLLE
DGGEAPAALEAALEEKSALEQMRKFLSDPQVHTVLVERSTLKEDVGDEGEEEKEFISYNI
NIDIHYGVKSNSLAFIKRTPVIDADKPVSSQLRVLTLSEDSPYETLHSFISNAVAPFFKS
YIRESGKADRDGDKMAPSVEKKIAELEMGLLHLQQNIEIPEISLPIHPMITNVAKQCYER
GEKPKVTDFGDKVEDPTFLNQLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLER
ALYRIQEKRESPEVLLTLDILKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFPLND
LLSATELDKIRQALVAIFTHLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMH
VAYEEFEKVMVACFEVFQTWDDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARL
DQMRKFRRQHEQLRAVIVRVLRPQVTAVAQQNQGEVPEPQDMKVAEVLFDAADANAIEEV
NLAYENVKEVDGLDVSKEGTEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFR
IFSRFNALFVRPHIRGAIREYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPP
VSGSIIWAKQIDRQLTAYMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWA
RKVQQRNLGVSGRIFTIESTRVRGRTGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLA
IVNKAHQANQLYPFAISLIESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGIALV
WESYKLDPYVQRLAETVFNFQEKVDDLLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQK
AVDDLNLHSYSNLPIWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAP
QVSHKPGGEPKIKNVVHELRITNQVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQSQR
YQVGVHYELTEEEKFYRNALTRMPDGPVALEESYSAVMGIVSEVEQYVKVWLQYQCLWDM
QAENIYNRLGEDLNKWQALLVQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDSW
HKEVLSKFGQMLGSNMTEFHSQISKSRQELEQHSVDTASTSDAVTFITYVQSLKRKIKQF
EKQVELYRNGQRLLEKQRFQFPPSWLYIDNIEGEWGAFNDIMRRKDSAIQQQVANLQMKI
VQEDRAVESRTTDLLTDWEKTKPVTGNLRPEEALQALTIYEGKFGRLKDDREKCAKAKEA
LELTDTGLLSGSEERVQVALEELQDLKGVWSELSKVWEQIDQMKEQPWVSVQPRKLRQNL
DALLNQLKSFPARLRQYASYEFVQRLLKGYMKINMLVIELKSEALKDRHWKQLMKRLHVN
WVVSELTLGQIWDVDLQKNEAIVKDVLLVAQGEMALEEFLKQIREVWNTYELDLVNYQNK
CRLIRGWDDLFNKVKEHINSVSAMKLSPYYKVFEEDALSWEDKLNRIMALFDVWIDVQRR
WVYLEGIFTGSADIKHLLPVETQRFQSISTEFLALMKKVSKSPLVMDVLNIQGVQRSLER
LADLLGKIQKALGEYLERERSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSS
IILNEDNSVVLGISSREGEEVMFKTPVSITEHPKINEWLTLVEKEMRVTLAKLLAESVTE
VEIFGKATSIDPNTYITWIDKYQAQLVVLSAQIAWSENVETALSSMGGGGDAAPLHSVLS
NVEVTLNVLADSVLMEQPPLRRRKLEHLITELVHQRDVTRSLIKSKIDNAKSFEWLSQMR
FYFDPKQTDVLQQLSIQMANAKFNYGFEYLGVQDKLVQTPLTDRCYLTMTQALEARLGGS
PFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRL
EERMLSAVSQQVQCIQEALREHSNPNYDKTSAPITCELLNKQVKVSPDMAIFITMNPGYA
GRSNLPDNLKKLFRSLAMTKPDRQLIAQVMLYSQGFRTAEVLANKIVPFFKLCDEQLSSQ
SHYDFGLRALKSVLVSAGNVKRERIQKIKREKEERGEAVDEGEIAENLPEQEILIQSVCE
TMVPKLVAEDIPLLFSLLSDVFPGVQYHRGEMTALREELKKVCQEMYLTYGDGEEVGGMW
VEKVLQLYQITQINHGLMMVGPSGSGKSMAWRVLLKALERLEGVEGVAHIIDPKAISKDH
LYGTLDPNTREWTDGLFTHVLRKIIDSVRGELQKRQWIVFDGDVDPEWVENLNSVLDDNK
LLTLPNGERLSLPPNVRIMFEVQDLKYATLATVSRCGMVWFSEDVLSTDMIFNNFLARLR
SIPLDEGEDEAQRRRKGKEDEGEEAASPMLQIQRDAATIMQPYFTSNGLVTKALEHAFQL
EHIMDLTRLRCLGSLFSMLHQACRNVAQYNANHPDFPMQIEQLERYIQRYLVYAILWSLS
GDSRLKMRAELGEYIRRITTVPLPTAPNIPIIDYEVSISGEWSPWQAKVPQIEVETHKVA
APDVVVPTLDTVRHEALLYTWLAEHKPLVLCGPPGSGKTMTLFSALRALPDMEVVGLNFS
SATTPELLLKTFDHYCEYRRTPNGVVLAPVQLGKWLVLFCDEINLPDMDKYGTQRVISFI
RQMVEHGGFYRTSDQTWVKLERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGPAS
LTQIYGTFNRAMLRLIPSLRTYAEPLTAAMVEFYTMSQERFTQDTQPHYIYSPREMTRWV
RGIFEALRPLETLPVEGLIRIWAHEALRLFQDRLVEDEERRWTDENIDTVALKHFPNIDR
EKAMSRPILYSNWLSKDYIPVDQEELRDYVKARLKVFYEEELDVPLVLFNEVLDHVLRID
RIFRQPQGHLLLIGVSGAGKTTLSRFVAWMNGLSVYQIKVHRKYTGEDFDEDLRTVLRRS
GCKNEKIAFIMDESNVLDSGFLERMNTLLANGEVPGLFEGDEYATLMTQCKEGAQKEGLM
LDSHEELYKWFTSQVIRNLHVVFTMNPSSEGLKDRAATSPALFNRCVLNWFGDWSTEALY
QVGKEFTSKMDLEKPNYIVPDYMPVVYDKLPQPPSHREAIVNSCVFVHQTLHQANARLAK
RGGRTMAITPRHYLDFINHYANLFHEKRSELEEQQMHLNVGLRKIKETVDQVEELRRDLR
IKSQELEVKNAAANDKLKKMVKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMSVKEDLD
KVEPAVIEAQNAVKSIKKQHLVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSIIM
RENFIPTIVNFSAEEISDAIREKMKKNYMSNPSYNYEIVNRASLACGPMVKWAIAQLNYA
DMLKRVEPLRNELQKLEDDAKDNQQKANEVEQMIRDLEASIARYKEEYAVLISEAQAIKA
DLAAVEAKVNRSTALLKSLSAERERWEKTSETFKNQMSTIAGDCLLSAAFIAYAGYFDQQ
MRQNLFTTWSHHLQQANIQFRTDIARTEYLSNADERLRWQASSLPADDLCTENAIMLKRF
NRYPLIIDPSGQATEFIMNEYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVESYDP
VLNPVLNREVRRTGGRVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDLCSRVTFVNFTV
TRSSLQSQCLNEVLKAERPDVDEKRSDLLKLQGEFQLRLRQLEKSLLQALNEVKGRILDD
DTIITTLENLKREAAEVTRKVEETDIVMQEVETVSQQYLPLSTACSSIYFTMESLKQIHF
LYQYSLQFFLDIYHNVLYENPNLKGVTDHTQRLSIITKDLFQVAFNRVARGMLHQDHITF
AMLLARIKLKGTVGEPTYDAEFQHFLRGNEIVLSAGSTPRIQGLTVEQAEAVVRLSCLPA
FKDLIAKVQADEQFGIWLDSSSPEQTVPYLWSEETPATPIGQAIHRLLLIQAFRPDRLLA
MAHMFVSTNLGESFMSIMEQPLDLTHIVGTEVKPNTPVLMCSVPGYDASGHVEDLAAEQN
TQITSIAIGSAEGFNQADKAINTAVKSGRWVMLKNVHLAPGWLMQLEKKLHSLQPHACFR
LFLTMEINPKVPVNLLRAGRIFVFEPPPGVKANMLRTFSSIPVSRICKSPNERARLYFLL
AWFHAIIQERLRYAPLGWSKKYEFGESDLRSACDTVDTWLDDTAKGRQNISPDKIPWSAL
KTLMAQSIYGGRVDNEFDQRLLNTFLERLFTTRSFDSEFKLACKVDGHKDIQMPDGIRRE
EFVQWVELLPDTQTPSWLGLPNNAERVLLTTQGVDMISKMLKMQMLEDEDDLAYAETEKK
TRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKL
LQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFS
ERIKQLQNISLAAASGGAKELKNIHVCLGGLFVPEAYITATRQYVAQANSWSLEELCLEV
NVTTSQGATLDACSFGVTGLKLQGATCNNNKLSLSNAISTALPLTQLRWVKQTNTEKKAS
VVTLPVYLNFTRADLIFTVDFEIATKEDPRSFYERGVAVLCTE

Sequence of entity 2 (C, E), FASTA

>9DZY_2 Platelet-activating factor acetylhydrolase IB subunit beta (chains C, E)
GSVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVI
RLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPV
FSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDF
QGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRM
VRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGS
ETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADD
KTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	6

Primary citation

Cryo-EM captures early intermediate steps in dynein activation by LIS1. Nguyen, K.H.V., Karasmanis, E.P., Kendrick, A.A. et al. Nat Commun (2025) 16:7054-7054. DOI 10.1038/s41467-025-62185-z · PubMed

Other PDB entries of the same protein (UniProt Q14204), best resolution first:

5OWO 1.79 Å, Human cytoplasmic Dynein N-Terminus dimerization domain at 1.8 Angstrom resolution
9BLZ 2.2 Å, State-1(phi motor) of full-length human dynein-1 in 5mM ATP
9BMR 2.6 Å, State-1 of motor domain from full-length human phi dynein-1 in 5 mM ADP
9DH5 2.6 Å, State-1 of the motor domain from full-length human dynein-1 in 5mM AMPPNP with 5mM Mg2+
9E0X 2.7 Å, Cryo-EM structure of Phi dynein
9E10 2.71 Å, Dimeric motor domains from phi dynein-1 under Lis1 condition
9BM0 2.8 Å, State-2 of motor domain from full-length human dynein-1 in 5mM ATP
9BMF 2.8 Å, State-1(phi motor) of full-length human dynein-1 in 5mM ATPVi
9BMH 2.8 Å, State-4 of motor domain from full-length human dynein-1 in 5mM ATPVi
9BN3 2.8 Å, The alpha registry-locked dynein motor domain mutant in 5mM ATP condition, class1
9BM2 2.82 Å, State-4 of motor domain from full-length human dynein-1 in 5 mM ATP
9BMG 2.86 Å, State-2 of full-length human dynein-1 in 5mM ATPVi

Browse structure collections

About this viewer

MolViewer shows 9DZY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.