9E4G: Acid-sensing ion channel 1

Human ASIC1a at pH 5.7 with linear transmembrane domain. Determined by electron microscopy at 2.8 Å resolution. Released 21 Jan 2026.

Method: Electron microscopy
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 3
Atoms: 10,024
Mol. weight: 180.76 kDa
Released: 21 Jan 2026

Explore 9E4G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9E4G contains 84 α-helices and 67 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	41-69	29
β-strand	73-80	8	1
β-strand	85-86	2	2
α-helix	87-88	2
β-strand	89-94	6	3
β-strand	96	1	4
β-strand	99	1	5
α-helix	105-111	7
α-helix	127-129	3
α-helix	132-141	10
α-helix	154-161	8
α-helix	163-164	2
α-helix	165-168	4
β-strand	169-174	6	1
β-strand	177-178	2	1
α-helix	181-183	3
β-strand	184-189	6	3
β-strand	192-197	6	3
α-helix	204-207	4
β-strand	208-209	2	2
β-strand	218-223	6	1
α-helix	226-228	3
β-strand	229	1	5
α-helix	230-231	2
β-strand	239	1	4
β-strand	243	1	6
β-strand	245-250	6	3
α-helix	258-261	4
α-helix	262	1
β-strand	263-265	3	3
β-strand	269-281	13	1
α-helix	283-284	2
β-strand	291	1	7
α-helix	307-323	17
β-strand	326	1	8
α-helix	335	1
β-strand	336	1	8
α-helix	337-338	2
α-helix	339-341	3
α-helix	342-346	5
α-helix	347-351	5
α-helix	352-356	5
α-helix	363-365	3
β-strand	366	1	7
β-strand	368-380	13	1
α-helix	387-393	7
α-helix	398-404	7
β-strand	405-424	20	1
α-helix	428-456	29

Chain B: 29 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	42-69	28
β-strand	73-80	8	6
β-strand	85-86	2	9
α-helix	87-88	2
β-strand	89-94	6	10
β-strand	99	1	11
α-helix	105-111	7
α-helix	132-141	10
α-helix	154-161	8
α-helix	163-164	2
α-helix	165-168	4
β-strand	169-174	6	6
β-strand	177-178	2	6
α-helix	179	1
α-helix	181-183	3
β-strand	184-189	6	10
β-strand	192-197	6	10
α-helix	200-202	3
α-helix	204-207	4
β-strand	208-209	2	9
α-helix	214-216	3
β-strand	218-223	6	6
α-helix	226-228	3
β-strand	229	1	11
α-helix	230-232	3
β-strand	243	1	12
β-strand	245-250	6	10
α-helix	258-261	4
α-helix	262	1
β-strand	263-265	3	10
β-strand	269-281	13	6
β-strand	291	1	13
α-helix	296-297	2
α-helix	307-323	17
β-strand	326	1	14
α-helix	335	1
β-strand	336	1	14
α-helix	337-338	2
α-helix	339-341	3
α-helix	342-346	5
α-helix	347-351	5
α-helix	352-356	5
α-helix	363-365	3
β-strand	366	1	13
β-strand	368-380	13	6
α-helix	387-393	7
α-helix	398-404	7
β-strand	405-424	20	6
α-helix	428-453	26
α-helix	454-456	3

Chain C: 29 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	44-69	26
β-strand	73-80	8	12
β-strand	85-86	2	15
α-helix	87-88	2
β-strand	89-94	6	16
β-strand	96	1	17
β-strand	99	1	18
α-helix	105-111	7
α-helix	132-141	10
α-helix	147-149	3
α-helix	154-161	8
α-helix	163-164	2
α-helix	165-168	4
β-strand	169-174	6	12
β-strand	177-178	2	12
α-helix	181-183	3
β-strand	184-189	6	16
β-strand	192-197	6	16
α-helix	200-202	3
α-helix	205-207	3
β-strand	208-209	2	15
β-strand	213-223	11	12
α-helix	226-228	3
β-strand	229	1	18
α-helix	230-231	2
β-strand	239	1	17
β-strand	243	1	1
β-strand	245-250	6	16
α-helix	258-261	4
β-strand	263-265	3	16
β-strand	269-281	13	12
α-helix	283-284	2
α-helix	290	1
β-strand	291	1	19
α-helix	292	1
α-helix	296-297	2
α-helix	307-323	17
β-strand	326	1	20
α-helix	335	1
β-strand	336	1	20
α-helix	337-338	2
α-helix	339-341	3
α-helix	342-346	5
α-helix	347-351	5
α-helix	352-356	5
α-helix	364-365	2
β-strand	366	1	19
β-strand	368-380	13	12
α-helix	384-393	10
α-helix	398-404	7
β-strand	405-424	20	12
α-helix	428-449	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acid-sensing ion channel 1	A, B, C	protein	531	Homo sapiens	P78348 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>9E4G_1 Acid-sensing ion channel 1 (chains A, B, C)
GGRMELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVL
LCVCTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLAL
LNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGE
VCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETD
ETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDS
DLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKD
QEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNY
ETIEQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKR
SSADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC

Primary citation

Conformational plasticity of human acid-sensing ion channel 1a. Cahill, J., Hartfield, K.A., Heusser, S.A. et al. Nat Struct Mol Biol (2026) 33:1171-1182. DOI 10.1038/s41594-026-01845-0 · PubMed

Other PDB entries of the same protein (UniProt P78348 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9E4I 2.33 Å, Human ASIC1a at pH 7.5 in complex with MitTx
9E4H 2.61 Å, Human ASIC1a at pH 5.7 with rotated, domain-swapped transmembrane domain
9E4F 2.69 Å, Human ASIC1a at pH 5.7 with domain-swapped transmembrane domain
9E4A 2.74 Å, Human ASIC1a at pH 8.5 with domain-swapped transmembrane domain
9E4K 2.77 Å, Human ASIC1a at pH 8.5, T26V mutation
6L6N 2.86 Å, hASIC1a co-crystallized with Nafamostat
7RNN 2.86 Å, Human ASIC1a-Nb.C1 complex
9E4J 2.87 Å, Human ASIC1a at pH 6.5 in complex with MitTx
9E4B 3.09 Å, Human ASIC1a at pH 7.5 with domain-swapped transmembrane domain
9E4E 3.16 Å, Human ASIC1a at pH 6.5 with linear transmembrane domain
9E4D 3.19 Å, Human ASIC1a at pH 7.5 with linear transmembrane domain
6L6I 3.24 Å, hASIC1a co-crystallized with Mamb-1

Browse structure collections

About this viewer

MolViewer shows 9E4G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.