9EAG: ApoB100 from Human Low-Density Lipoprotein

The Structure of ApoB100 from Human Low-Density Lipoprotein. Determined by electron microscopy at 9.0 Å resolution. Released 18 Dec 2024.

Method: Electron microscopy
Resolution: 9.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 36,083
Mol. weight: 516.17 kDa
Released: 18 Dec 2024

Explore 9EAG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9EAG contains 104 α-helices and 259 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 104 helices, 259 β-strands

Element	Residues	Length	Sheet
α-helix	41-43	3
β-strand	50-63	14	1
β-strand	71-86	16	1
β-strand	89-101	13	1
β-strand	104-105	2	2
β-strand	111-112	2	2
β-strand	115	1	1
α-helix	119-126	8
β-strand	131-134	4	1
α-helix	136-138	3
β-strand	142-144	3	1
α-helix	151-164	14
α-helix	167-169	3
β-strand	177-181	5	3
β-strand	184-188	5	3
β-strand	191-196	6	1
β-strand	199-208	10	1
α-helix	209-211	3
α-helix	217-218	2
α-helix	232-237	6
β-strand	239-249	11	1
β-strand	256-267	12	1
β-strand	278-290	13	1
β-strand	293	1	1
β-strand	306	1	1
α-helix	320-338	19
α-helix	345-356	12
α-helix	361-373	13
α-helix	376-383	8
α-helix	388-401	14
α-helix	405-416	12
α-helix	423-436	14
α-helix	439-455	17
α-helix	461-474	14
α-helix	483-502	20
α-helix	504-514	11
α-helix	521-530	10
α-helix	531-533	3
α-helix	539-549	11
α-helix	555-565	11
α-helix	571-580	10
α-helix	581-583	3
α-helix	587-602	16
α-helix	607-618	12
α-helix	625-627	3
β-strand	635-643	9	4
α-helix	644-645	2
β-strand	651-660	10	4
β-strand	670-678	9	4
β-strand	685-695	11	4
α-helix	697-704	8
α-helix	710-721	12
α-helix	725-727	3
α-helix	728-737	10
α-helix	749-765	17
α-helix	769-771	3
β-strand	772-779	8	4
β-strand	782-788	7	4
α-helix	789-807	19
α-helix	809-819	11
β-strand	823-825	3	5
β-strand	829-839	11	6
β-strand	845-854	10	6
β-strand	858-860	3	5
β-strand	863-865	3	7
β-strand	870-875	6	7
β-strand	876-877	2	5
β-strand	878-891	14	6
β-strand	895-908	14	6
β-strand	911-918	8	7
β-strand	921-927	7	7
α-helix	928-929	2
β-strand	933-944	12	6
β-strand	951-952	2	6
α-helix	954-956	3
β-strand	960-967	8	6
β-strand	973-982	10	6
β-strand	999-1007	9	6
β-strand	1011-1017	7	7
β-strand	1020	1	8
β-strand	1023-1025	3	9
β-strand	1028-1030	3	9
β-strand	1033	1	8
α-helix	1038	1
β-strand	1039-1041	3	7
β-strand	1048-1050	3	9
β-strand	1051	1	8
β-strand	1053-1054	2	9
β-strand	1059-1066	8	9
β-strand	1071-1081	11	9
β-strand	1087	1	10
β-strand	1090-1098	9	9
β-strand	1101-1112	12	9
β-strand	1113	1	10
β-strand	1118-1120	3	9
β-strand	1123-1125	3	9
β-strand	1131-1134	4	9
β-strand	1136-1140	5	9
β-strand	1147-1151	5	9
β-strand	1154-1156	3	9
β-strand	1159-1161	3	9
β-strand	1164-1168	5	9
β-strand	1173-1184	12	9
α-helix	1186-1192	7
α-helix	1201-1212	12
α-helix	1223-1240	18
α-helix	1246-1258	13
β-strand	1278-1288	11	9
β-strand	1294-1299	6	11
α-helix	1308-1310	3
β-strand	1315-1317	3	12
β-strand	1321-1323	3	13
β-strand	1328-1330	3	13
β-strand	1334-1336	3	12
α-helix	1337-1339	3
β-strand	1345-1350	6	11
β-strand	1356-1364	9	9
β-strand	1367-1373	7	9
β-strand	1374	1	14
β-strand	1377	1	9
β-strand	1384-1386	3	9
β-strand	1388	1	14
β-strand	1389-1395	7	9
β-strand	1402-1406	5	9
β-strand	1408-1413	6	9
β-strand	1417-1427	11	9
β-strand	1431-1442	12	9
β-strand	1449-1459	11	9
β-strand	1464-1476	13	9
β-strand	1479-1491	13	9
β-strand	1496-1508	13	9
β-strand	1513-1524	12	9
β-strand	1528-1538	11	9
β-strand	1541-1550	10	9
β-strand	1555-1564	10	9
β-strand	1567-1578	12	9
β-strand	1581-1585	5	9
β-strand	1588-1590	3	9
β-strand	1598-1603	6	9
β-strand	1606	1	15
β-strand	1609	1	15
β-strand	1610-1619	10	9
β-strand	1624-1633	10	9
β-strand	1638-1647	10	9
β-strand	1651-1662	12	9
β-strand	1665-1676	12	9
β-strand	1679-1690	12	9
β-strand	1694-1703	10	9
β-strand	1708-1716	9	9
α-helix	1718-1720	3
β-strand	1722-1731	10	9
β-strand	1736-1746	11	9
β-strand	1749-1759	11	9
β-strand	1764-1773	10	9
β-strand	1779-1789	11	9
β-strand	1792-1803	12	9
β-strand	1806-1815	10	9
β-strand	1820-1831	12	9
β-strand	1834-1845	12	9
β-strand	1848-1859	12	9
β-strand	1862-1868	7	9
β-strand	1878-1886	9	9
β-strand	1890-1899	10	9
β-strand	1905-1917	13	9
β-strand	1922-1936	15	9
β-strand	1939-1953	15	9
β-strand	1959-1973	15	9
β-strand	1976-1987	12	9
β-strand	1990-2000	11	9
β-strand	2005-2015	11	9
α-helix	2036-2040	5
α-helix	2049	1
β-strand	2050-2069	20	9
α-helix	2072-2101	30
α-helix	2104-2128	25
α-helix	2131-2143	13
α-helix	2144-2148	5
α-helix	2153-2186	34
α-helix	2190-2216	27
α-helix	2218-2235	18
α-helix	2244-2254	11
α-helix	2258-2274	17
α-helix	2278-2291	14
α-helix	2294-2304	11
α-helix	2308-2327	20
α-helix	2331-2348	18
α-helix	2350-2368	19
α-helix	2370-2381	12
α-helix	2386-2406	21
α-helix	2409-2428	20
α-helix	2432-2456	25
α-helix	2459-2484	26
α-helix	2489-2497	9
α-helix	2506-2523	18
α-helix	2528-2568	41
α-helix	2571-2578	8
α-helix	2579-2583	5
β-strand	2585-2587	3	16
β-strand	2590-2591	2	17
β-strand	2595	1	18
β-strand	2596-2597	2	17
α-helix	2598-2599	2
β-strand	2600-2602	3	16
α-helix	2605-2609	5
β-strand	2612-2613	2	19
β-strand	2617	1	18
β-strand	2626	1	18
β-strand	2630-2631	2	19
β-strand	2644-2647	4	20
α-helix	2648-2649	2
β-strand	2650-2652	3	21
β-strand	2656-2658	3	21
β-strand	2661-2664	4	20
α-helix	2665-2681	17
α-helix	2686-2688	3
α-helix	2698-2700	3
α-helix	2722-2724	3
α-helix	2739-2741	3
β-strand	2750-2765	16	9
β-strand	2771	1	9
β-strand	2774-2779	6	9
β-strand	2789-2796	8	9
β-strand	2807-2813	7	9
β-strand	2825-2831	7	9
β-strand	2835-2846	12	9
β-strand	2849-2861	13	9
β-strand	2865-2877	13	9
β-strand	2881-2895	15	9
β-strand	2900-2915	16	9
β-strand	2918-2924	7	9
β-strand	2927-2932	6	9
β-strand	2939-2943	5	9
β-strand	2946-2951	6	9
β-strand	2954-2965	12	9
β-strand	2968-2979	12	9
β-strand	2983-2994	12	9
β-strand	2998-3009	12	9
β-strand	3014-3025	12	9
β-strand	3029-3030	2	22
β-strand	3031-3042	12	9
β-strand	3045-3054	10	9
β-strand	3057-3060	4	22
β-strand	3064-3067	4	22
β-strand	3068-3078	11	9
β-strand	3083-3089	7	9
β-strand	3092-3093	2	9
β-strand	3096-3106	11	9
β-strand	3111-3121	11	9
α-helix	3124-3127	4
β-strand	3130-3132	3	23
β-strand	3136	1	24
β-strand	3143	1	24
α-helix	3144-3146	3
β-strand	3147-3150	4	23
α-helix	3152-3155	4
α-helix	3158-3161	4
β-strand	3167-3174	8	9
β-strand	3177	1	9
β-strand	3183-3187	5	25
α-helix	3191-3224	34
α-helix	3227-3231	5
β-strand	3244-3248	5	26
β-strand	3251-3253	3	27
β-strand	3258-3260	3	27
β-strand	3263-3267	5	26
β-strand	3275	1	26
β-strand	3278-3280	3	28
β-strand	3284	1	27
β-strand	3295-3297	3	28
α-helix	3317-3320	4
β-strand	3328-3332	5	25
β-strand	3336-3337	2	9
β-strand	3339-3344	6	9
β-strand	3348-3357	10	9
β-strand	3362-3372	11	9
β-strand	3379-3387	9	9
β-strand	3395-3402	8	9
β-strand	3406-3416	11	9
β-strand	3421-3431	11	9
β-strand	3433	1	9
β-strand	3436	1	9
β-strand	3439-3445	7	9
β-strand	3448	1	9
β-strand	3452-3466	15	9
β-strand	3471-3485	15	9
β-strand	3490-3504	15	9
β-strand	3508-3509	2	9
β-strand	3514-3521	8	9
β-strand	3525-3533	9	9
β-strand	3538	1	9
β-strand	3545-3546	2	29
β-strand	3550-3555	6	9
β-strand	3559-3562	4	9
β-strand	3567-3568	2	29
β-strand	3570-3571	2	30
β-strand	3579-3580	2	30
β-strand	3583	1	31
β-strand	3587-3592	6	9
β-strand	3595-3602	8	9
β-strand	3604	1	31
β-strand	3615	1	9
β-strand	3618-3625	8	9
β-strand	3628-3639	12	9
β-strand	3642-3652	11	9
β-strand	3656-3667	12	9
β-strand	3676-3677	2	32
β-strand	3682-3683	2	32
α-helix	3684-3688	5
β-strand	3700-3712	13	9
β-strand	3717-3720	4	33
β-strand	3724-3725	2	34
β-strand	3729-3732	4	34
β-strand	3743-3746	4	35
β-strand	3749-3750	2	36
α-helix	3751	1
β-strand	3757-3758	2	36
α-helix	3759-3760	2
β-strand	3761-3764	4	35
β-strand	3768-3771	4	34
β-strand	3773-3776	4	37
β-strand	3779	1	38
β-strand	3789-3790	2	39
β-strand	3791	1	38
β-strand	3794-3801	8	37
β-strand	3810-3815	6	37
β-strand	3818-3822	5	39
β-strand	3825-3827	3	40
β-strand	3831-3832	2	41
β-strand	3837-3838	2	41
α-helix	3840-3848	9
α-helix	3851-3854	4
β-strand	3855-3857	3	40
β-strand	3860-3864	5	39
β-strand	3867-3872	6	37
β-strand	3874-3877	4	33
α-helix	3878-3879	2
β-strand	3880-3891	12	9
β-strand	3894-3905	12	9
β-strand	3908-3919	12	9
β-strand	3926-3937	12	9
β-strand	3940-3950	11	9
β-strand	3955-3965	11	9
β-strand	3969-3978	10	9
β-strand	3986-3993	8	9
β-strand	3996-4003	8	9
β-strand	4007-4015	9	9
β-strand	4019-4028	10	9
β-strand	4036-4045	10	9
β-strand	4052-4058	7	9
α-helix	4060-4092	33
α-helix	4098-4159	62
α-helix	4165-4198	34
β-strand	4202	1	42
β-strand	4211	1	42
α-helix	4213-4252	40
α-helix	4258-4287	30
α-helix	4292-4319	28
α-helix	4323-4388	66
α-helix	4395-4454	60
α-helix	4461-4505	45
α-helix	4509-4543	35
β-strand	4551-4555	5	9
β-strand	4558-4562	5	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apolipoprotein B 100	A	protein	4563	Homo sapiens	P04114

Sequence of entity 1 (A), FASTA

>9EAG_1 Apolipoprotein B 100 (chains A)
MDPPRPALLALLALPALLLLLLAGARAEEEMLENVSLVCPKDATRFKHLRKYTYNYEAES
SSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSE
EFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYILNIKRGIISALLVPPETEEAKQVLFLD
TVYGNCSTHFTVKTRKGNVATEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLIS
SSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFG
EGTKKMGLAFESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSD
EAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPE
PSAQQLREIFNMARDQRSRATLYALSHAVNNYHKTNPTGTQELLDIANYLMEQIQDDCTG
DEDYTYLILRVIGNMGQTMEQLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKD
QEVLLQTFLDDASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANI
LNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLI
FDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALFGKQGFFPDSVNKALY
WVNGQVPDGVSKVLVDHFGYTKDDKHEQDMVNGIMLSVEKLIKDLKSKEVPEARAYLRIL
GEELGFASLHDLQLLGKLLLMGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPT
GAGLQLQISSSGVIAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQ
MNTNFFHESGLEAHVALKAGKLKFIIPSPKRPVKLLSGGNTLHLVSTTKTEVIPPLIENR
QSWSVCKQVFPGLNYCTSGAYSNASSTDSASYYPLTGDTRLELELRPTGEIEQYSVSATY
ELQREDRALVDTLKFVTQAEGAKQTEATMTFKYNRQSMTLSSEVQIPDFDVDLGTILRVN
DESTEGKTSYRLTLDIQNKKITEVALMGHLSCDTKEERKIKGVISIPRLQAEARSEILAH
WSPAKLLLQMDSSATAYGSTVSKRVAWHYDEEKIEFEWNTGTNVDTKKMTSNFPVDLSDY
PKSLHMYANRLLDHRVPQTDMTFRHVGSKLIVAMSSWLQKASGSLPYTQTLQDHLNSLKE
FNLQNMGLPDFHIPENLFLKSDGRVKYTLNKNSLKIEIPLPFGGKSSRDLKMLETVRTPA
LHFKSVGFHLPSREFQVPTFTIPKLYQLQVPLLGVLDLSTNVYSNLYNWSASYSGGNTST
DHFSLRARYHMKADSVVDLLSYNVQGSGETTYDHKNTFTLSCDGSLRHKFLDSNIKFSHV
EKLGNNPVSKGLLIFDASSSWGPQMSASVHLDSKKKQHLFVKEVKIDGQFRVSSFYAKGT
YGLSCQRDPNTGRLNGESNLRFNSSYLQGTNQITGRYEDGTLSLTSTSDLQSGIIKNTAS
LKYENYELTLKSDTNGKYKNFATSNKMDMTFSKQNALLRSEYQADYESLRFFSLLSGSLN
SHGLELNADILGTDKINSGAHKATLRIGQDGISTSATTNLKCSLLVLENELNAELGLSGA
SMKLTTNGRFREHNAKFSLDGKAALTELSLGSAYQAMILGVDSKNIFNFKVSQEGLKLSN
DMMGSYAEMKFDHTNSLNIAGLSLDFSSKLDNIYSSDKFYKQTVNLQLQPYSLVTTLNSD
LKYNALDLTNNGKLRLEPLKLHVAGNLKGAYQNNEIKHIYAISSAALSASYKADTVAKVQ
GVEFSHRLNTDIAGLASAIDMSTNYNSDSLHFSNVFRSVMAPFTMTIDAHTNGNGKLALW
GEHTGQLYSKFLLKAEPLAFTFSHDYKGSTSHHLVSRKSISAALEHKVSALLTPAEQTGT
WKLKTQFNNNEYSQDLDAYNTKDKIGVELTGRTLADLTLLDSPIKVPLLLSEPINIIDAL
EMRDAVEKPQEFTIVAFVKYDKNQDVHSINLPFFETLQEYFERNRQTIIVVLENVQRNLK
HINIDQFVRKYRAALGKLPQQANDYLNSFNWERQVSHAKEKLTALTKKYRITENDIQIAL
DDAKINFNEKLSQLQTYMIQFDQYIKDSYDLHDLKIAIANIIDEIIEKLKSLDEHYHIRV
NLVKTIHDLHLFIENIDFNKSGSSTASWIQNVDTKYQIRIQIQEKLQQLKRHIQNIDIQH
LAGKLKQHIEAIDVRVLLDQLGTTISFERINDILEHVKHFVINLIGDFEVAEKINAFRAK
VHELIERYEVDQQIQVLMDKLVELAHQYKLKETIQKLSNVLQQVKIKDYFEKLVGFIDDA
VKKLNELSFKTFIEDVNKFLDMLIKKLKSFDYHQFVDETNDKIREVTQRLNGEIQALELP
QKAEALKLFLEETKATVAVYLESLQDTKITLIINWLQEALSSASLAHMKAKFRETLEDTR
DRMYQMDIQQELQRYLSLVGQVYSTLVTYISDWWTLAAKNLTDFAEQYSIQDWAKRMKAL
VEQGFTVPEIKTILGTMPAFEVSLQALQKATFQTPDFIVPLTDLRIPSVQINFKDLKNIK
IPSRFSTPEFTILNTFHIPSFTIDFVEMKVKIIRTIDQMLNSELQWPVPDIYLRDLKVED
IPLARITLPDFRLPEIAIPEFIIPTLNLNDFQVPDLHIPEFQLPHISHTIEVPTFGKLYS
ILKIQSPLFTLDANADIGNGTTSANEAGIAASITAKGESKLEVLNFDFQANAQLSNPKIN
PLALKESVKFSSKYLRTEHGSEMLFFGNAIEGKSNTVASLHTEKNTLELSNGVIVKINNQ
LTLDSNTKYFHKLNIPKLDFSSQADLRNEIKTLLKAGHIAWTSSGKGSWKWACPRFSDEG
THESQISFTIEGPLTSFGLSNKINSKHLRVNQNLVYESGSLNFSKLEIQSQVDSQHVGHS
VLTAKGMALFGEGKAEFTGRHDAHLNGKVIGTLKNSLFFSAQPFEITASTNNEGNLKVRF
PLRLTGKIDFLNNYALFLSPSAQQASWQVSARFNQYKYNQNFSAGNNENIMEAHVGINGE
ANLDFLNIPLTIPEMRLPYTIITTPPLKDFSLWEKTGLKEFLKTTKQSFDLSVKAQYKKN
KHRHSITNPLAVLCEFISQSIKSFDRHFEKNRNNALDFVTKSYNETKIKFDKYKAEKSHD
ELPRTFQIPGYTVPVVNVEVSPFTIEMSAFGYVFPKAVSMPSFSILGSDVRVPSYTLILP
SLELPVLHVPRNLKLSLPDFKELCTISHIFIPAMGNITYDFSFKSSVITLNTNAELFNQS
DIVAHLLSSSSSVIDALQYKLEGTTRLTRKRGLKLATALSLSNKFVEGSHNSTVSLTTKN
MEVSVATTTKAQIPILRMNFKQELNGNTKSKPTVSSSMEFKYDFNSSMLYSTAKGAVDHK
LSLESLTSYFSIESSTKGDVKGSVLSREYSGTIASEANTYLNSKSTRSSVKLQGTSKIDD
IWNLEVKENFAGEATLQRIYSLWEHSTKNHLQLEGLFFTNGEHTSKATLELSPWQMSALV
QVHASQPSSFHDFPDLGQEVALNANTKNQKIRWKNEVRIHSGSFQSQVELSNDQEKAHLD
IAGSLEGHLRFLKNIILPVYDKSLWDFLKLDVTTSIGRRQHLRVSTAFVYTKNPNGYSFS
IPVKVLADKFIIPGLKLNDLNSVLVMPTFHVPFTDLQVPSCKLDFREIQIYKKLRTSSFA
LNLPTLPEVKFPEVDVLTKYSQPEDSLIPFFEITVPESQLTVSQFTLPKSVSDGIAALDL
NAVANKIADFELPTIIVPEQTIEIPSIKFSVPAGIVIPSFQALTARFEVDSPVYNATWSA
SLKNKADYVETVLDSTCSSTVQFLEYELNVLGTHKIEDGTLASKTKGTFAHRDFSAEYEE
DGKYEGLQEWEGKAHLNIKSPAFTDLHLRYQKDKKGISTSAASPAVGTVGMDMDEDDDFS
KWNFYYSPQSSPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV
LYDYVNKYHWEHTGLTLREVSSKLRRNLQNNAEWVYQGAIRQIDDIDVRFQKAASGTTGT
YQEWKDKAQNLYQELLTQEGQASFQGLKDNVFDGLVRVTQEFHMKVKHLIDSLIDFLNFP
RFQFPGKPGIYTREELCTMFIREVGTVLSQVYSKVHNGSEILFSYFQDLVITLPFELRKH
KLIDVISMYRELLKDLSKEAQEVFKAIQSLKTTEVLRNLQDLLQFIFQLIEDNIKQLKEM
KFTYLINYIQDEINTIFSDYIPYVFKLLKENLCLNLHKFNEFIQNELQEASQELQQIHQY
IMALREEYFDPSIVGWTVKYYELEEKIVSLIKNLLVALKDFHSEYIVSASNFTSQLSSQV
EQFLHRNIQEYLSILTDPDGKGKEKIAELSATAQEIIKSQAIATKKIISDYHQQFRYKLQ
DFSDQLSDYYEKFIAESKRLIDLSIQNYHTFLIYITELLKKLQSTTVMNPYMKLAPGELT
IIL

Primary citation

The structure of apolipoprotein B100 from human low-density lipoprotein. Berndsen, Z.T., Cassidy, C.K. Nature (2025) 638:836-843. DOI 10.1038/s41586-024-08467-w · PubMed

Other PDB entries of the same protein (UniProt P04114), best resolution first:

9COO 3.73 Å, Nanobody 4 bound to Apolipoprotein B 100
9BDE 4.18 Å, Middle Region of Apolipoprotein B 100 bound to Low Density Lipoprotein Receptor
9BD8 4.8 Å, ApoB 100 beta barrel bound to LDLR beta propeller
9BD1 5.4 Å, beta/alpha1 region of ApoB 100
9BDT 5.4 Å, Apolipoprotein B 100 bound to LDL receptor and legobody
9E9R 9.0 Å, The Structure of ApoB100 from Human Low-Density Lipoprotein
9EA7 9.0 Å, The Structure of ApoB100 from Human Low-Density Lipoprotein

Browse structure collections

About this viewer

MolViewer shows 9EAG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.