Crystal Structure of the Gemella haemolysans Immunoglobulin A1 Protease Trypsin-Like Domain. Determined by X-ray diffraction at 1.75 Å resolution. Released 12 Mar 2025.
Explore 9ECT in 3D Show helices and sheets RCSB PDB PDBe
9ECT contains 25 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 686-690 | 5 | |
| β-strand | 691-700 | 10 | 1 |
| β-strand | 703-715 | 13 | 1 |
| β-strand | 718-721 | 4 | 1 |
| α-helix | 723-725 | 3 | |
| β-strand | 727-729 | 3 | 2 |
| β-strand | 736-738 | 3 | 2 |
| β-strand | 746-750 | 5 | 1 |
| β-strand | 756-759 | 4 | 1 |
| α-helix | 761-763 | 3 | |
| β-strand | 764-766 | 3 | 1 |
| α-helix | 772-774 | 3 | |
| α-helix | 776-778 | 3 | |
| β-strand | 781-784 | 4 | 1 |
| α-helix | 794-795 | 2 | |
| β-strand | 796 | 1 | 3 |
| α-helix | 797 | 1 | |
| β-strand | 808-813 | 6 | 3 |
| α-helix | 815-817 | 3 | |
| β-strand | 820-826 | 7 | 3 |
| α-helix | 827 | 1 | |
| β-strand | 829-834 | 6 | 3 |
| β-strand | 837-841 | 5 | 3 |
| α-helix | 852 | 1 | |
| β-strand | 853-855 | 3 | 3 |
| β-strand | 861-867 | 7 | 3 |
| β-strand | 874-877 | 4 | 3 |
| α-helix | 878-879 | 2 | |
| α-helix | 880-890 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 686-690 | 5 | |
| β-strand | 691-700 | 10 | 4 |
| β-strand | 703-715 | 13 | 4 |
| β-strand | 718-721 | 4 | 4 |
| α-helix | 723-725 | 3 | |
| β-strand | 727-729 | 3 | 5 |
| β-strand | 736-738 | 3 | 5 |
| β-strand | 746-750 | 5 | 4 |
| β-strand | 756-759 | 4 | 4 |
| α-helix | 761-763 | 3 | |
| β-strand | 764-766 | 3 | 4 |
| α-helix | 772-774 | 3 | |
| α-helix | 776-778 | 3 | |
| β-strand | 781-784 | 4 | 4 |
| α-helix | 785-786 | 2 | |
| α-helix | 794-795 | 2 | |
| β-strand | 796 | 1 | 6 |
| α-helix | 797 | 1 | |
| β-strand | 808-813 | 6 | 6 |
| α-helix | 815-817 | 3 | |
| β-strand | 820-826 | 7 | 6 |
| β-strand | 829-834 | 6 | 6 |
| β-strand | 837-841 | 5 | 6 |
| α-helix | 852 | 1 | |
| β-strand | 853-855 | 3 | 6 |
| β-strand | 861-865 | 5 | 6 |
| α-helix | 869-871 | 3 | |
| β-strand | 874-877 | 4 | 6 |
| α-helix | 878-879 | 2 | |
| α-helix | 880-891 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| LPXTG-motif cell wall anchor domain protein | A, B | protein | 215 | Gemella haemolysans | C5NYF3 |
>9ECT_1 LPXTG-motif cell wall anchor domain protein (chains A, B) GSNNVPKNASALLRMNFVKGNQVLSGTGSATFIAPNVLLTVAHNFINNSADNSTGEFIGD KSKNTYEWQTPDGQKGSFTSEDIHFYNKKDYPKGFIYDLAVITLPQSTRRQHANLVENYS KVNVNDKLNVYGYPRGEYAHLKDTTVEIEQKYANNTYGVQYQGGKAGMSGGGIFNSKGEV IGLHQNGAENRSGGLILSPTQLDWIRSIIKGKEIT
The structure of the Gemella haemolysans M26 IgA1 protease trypsin-like domain. Tran, N., Redzic, J.S., Eisenmesser, E.Z. et al. Acta Crystallogr F Struct Biol Commun (2025) 81:124-129. DOI 10.1107/S2053230X25001219 · PubMed
Other PDB entries of the same protein (UniProt C5NYF3), best resolution first:
MolViewer shows 9ECT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.