UP1 in complex with EN300-805013. Determined by X-ray diffraction at 1.42 Å resolution. Released 8 May 2024.
Explore 9F4T in 3D Show helices and sheets RCSB PDB PDBe
9F4T contains 9 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-10 | 3 | |
| α-helix | 11-14 | 4 | |
| β-strand | 15-19 | 5 | 1 |
| α-helix | 27-34 | 8 | |
| α-helix | 35-37 | 3 | |
| β-strand | 40-47 | 8 | 1 |
| β-strand | 54-62 | 9 | 1 |
| α-helix | 65-73 | 9 | |
| α-helix | 75 | 1 | |
| α-helix | 77 | 1 | |
| β-strand | 78-79 | 2 | 2 |
| β-strand | 82-83 | 2 | 2 |
| β-strand | 85-88 | 4 | 1 |
| β-strand | 106-110 | 5 | 3 |
| α-helix | 118-125 | 8 | |
| β-strand | 131-138 | 8 | 3 |
| β-strand | 145-153 | 9 | 3 |
| α-helix | 156-164 | 9 | |
| β-strand | 169-170 | 2 | 4 |
| β-strand | 173-174 | 2 | 4 |
| β-strand | 176-179 | 4 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed | A | protein | 198 | Homo sapiens | P09651 (AlphaFold model) |
>9F4T_1 Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed (chains A) GPMGSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGF GFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTE EHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEV RKALSKQEMASASSSQRG
| ID | Name | Formula | Copies |
|---|---|---|---|
| WZY | N-(4-methoxyphenyl)glycinamide | C9 H12 N2 O2 | 1 |
Enhanced identification of small molecules binding to hnRNPA1 via cryptic pockets mapping coupled with X-ray fragment screening. Dunnett, L., Das, S., Venditti, V. et al. J Biol Chem (2025) 301:108335-108335. DOI 10.1016/j.jbc.2025.108335 · PubMed
Other PDB entries of the same protein (UniProt P09651 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9F4T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.