9F9G: Bacteriorhodopsin

Laser excitation effects on BR: Reprocessed Dark from Nogly et al. Determined by X-ray diffraction at 1.44 Å resolution. Released 22 Jan 2025.

Method: X-ray diffraction
Resolution: 1.44 Å
Organism: Halobacterium salinarum
Chains: 1
Atoms: 2,176
Mol. weight: 35.04 kDa
Ligands: RET, OLC, LI1
Released: 22 Jan 2025

Explore 9F9G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9F9G contains 13 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	10-31	22
α-helix	37-61	25
β-strand	67-71	5	1
β-strand	74-78	5	1
α-helix	81-100	20
α-helix	105-127	23
α-helix	131-151	21
α-helix	152-156	5
α-helix	157-160	4
α-helix	165-191	27
α-helix	201-213	13
α-helix	214-218	5
α-helix	219-224	6
α-helix	227-229	3
α-helix	231-232	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bacteriorhodopsin	A	protein	231	Halobacterium salinarum	P02945 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9F9G_1 Bacteriorhodopsin (chains A)
ITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLG
YGLTMVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGL
VGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKAESMRPEVASTFKVLRNVTVVLWS
AYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAE

Ligands and cofactors

ID	Name	Formula	Copies
RET	Retinal	C20 H28 O	1
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	5
LI1	1-[2,6,10.14-tetramethyl-hexadecan-16-yl]-2-[2,10,14-trimethylhexadecan-16-yl]g…	C42 H86 O3	12

Primary citation

Structural effects of high laser power densities on an early bacteriorhodopsin photocycle intermediate. Bertrand, Q., Nogly, P., Nango, E. et al. Nat Commun (2024) 15:10278-10278. DOI 10.1038/s41467-024-54422-8 · PubMed

Other PDB entries of the same protein (UniProt P02945 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z09 1.05 Å, Crystal structure of the ground state of bacteriorhodopsin at 1.05 Angstrom resolution
7Z0D 1.2 Å, Crystal structure of the L state of bacteriorhodopsin at 1.20 Angstrom resolution
7Z0A 1.22 Å, Crystal structure of the ground state of bacteriorhodopsin at 1.22 Angstrom resolution
7Z0E 1.22 Å, Crystal structure of the M state of bacteriorhodopsin at 1.22 Angstrom resolution
5ZIM 1.25 Å, Crystal structure of bacteriorhodopsin at 1.25 A resolution
5ZIN 1.27 Å, Crystal structure of bacteriorhodopsin at 1.27 A resolution
5ZIL 1.29 Å, Crystal structure of bacteriorhodopsin at 1.29 A resolution
7XJC 1.33 Å, Crystal structure of bacteriorhodopsin in the ground and K states after green laser…
7XJD 1.33 Å, Crystal structure of bacteriorhodopsin in the ground state by red laser irradiation
7XJE 1.33 Å, Crystal structure of bacteriorhodopsin in the K state refined against the extrapolated…
1M0K 1.43 Å, Bacteriorhodopsin K intermediate at 1.43 a resolution
1M0M 1.43 Å, Bacteriorhodopsin M1 intermediate at 1.43 a resolution

Browse structure collections

About this viewer

MolViewer shows 9F9G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.