9FAN: Gamma2 subunit of GABA(A)R

CryoEM structure of gamma2 subunit of GABA(A)R in complex with GARLH4, the TMD of Neuroligin2 from desensitised state obtained by focused refinement. Determined by electron microscopy at 2.9 Å resolution. Released 2 Jul 2025.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,348
Mol. weight: 34.47 kDa
Ligands: PGW, D10, CLR, PLM
Released: 2 Jul 2025

Explore 9FAN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9FAN contains 11 α-helices and 7 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	375-379	5
α-helix	402-423	22
α-helix	424-428	5

Chain H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	674-698	25

Chain L: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	12-42	31
β-strand	47-48	2	1
β-strand	57-59	3	1
β-strand	64-66	3	1
β-strand	76-78	3	1
α-helix	90-112	23
α-helix	113-116	4
α-helix	121-145	25
α-helix	146-151	6
α-helix	153-159	7
β-strand	164	1	2
β-strand	167	1	2
β-strand	172-173	2	1
α-helix	175-202	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of Gamma-aminobutyric acid receptor subunit gamma-2	C	protein	61	Homo sapiens	P18507 (AlphaFold model)
Neuroligin-2	H	protein	33	Homo sapiens	Q8NFZ4 (AlphaFold model)
LHFPL tetraspan subfamily member 4 protein	L	protein	193	Homo sapiens	Q7Z7J7 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>9FAN_1 Isoform 2 of Gamma-aminobutyric acid receptor subunit gamma-2 (chains C)
CLDGKDCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL
G

Sequence of entity 2 (H), FASTA

>9FAN_2 Neuroligin-2 (chains H)
DSRDYSTELSVTVAVGASLLFLNILAFAALYYK

Sequence of entity 3 (L), FASTA

>9FAN_3 LHFPL tetraspan subfamily member 4 protein (chains L)
YHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFGLFHYCVGSGL
AGRELTCRGSFTDFSTIPSSAFKAAAFFVLLSMVLILGCITCFSLFFFCNTATVYKICAW
MQLLAALCLVLGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILAIIGILNALIL
SFLAFVLGNRQTD

Ligands and cofactors

ID	Name	Formula	Copies
PGW	(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexade…	C40 H77 O10 P	1
D10	Decane	C10 H22	1
CLR	Cholesterol	C27 H46 O	1
PLM	Palmitic acid	C16 H32 O2	1

Water and common crystallization additives (CL) are not listed.

Primary citation

CryoEM structure of gamma2 subunit of GABA(A)R in complex with GARLH4, the TMD of Neuroligin2 from desensitised state obtained by focused refinement. Kasaragod, V.B., Aricescu, A.R. To be published.

Other PDB entries of the same protein (UniProt P18507 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RGD 2.0 Å, CryoEM structure of human alpha1beta3gamma2L GABA(A)R in CL47a
8BHG 2.39 Å, GABA-A receptor a5 heteromer - a5V2 - Bretazenil
9EQG 2.4 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with GABA…
9FAS 2.5 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with…
6X3T 2.55 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus propofol
8VRN 2.57 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus PPTQ
9FAJ 2.6 Å, CryoEM structure of human full-length alpha1beta3gamma2 GABA(A) receptor in complex with…
9FAK 2.6 Å, CryoEM structure of human full-length alpha1beta3gamma2 GABA(A) receptor in complex with…
9FGG 2.6 Å, Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in Saposin A…
8SGO 2.65 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus pregnenolone…
7QNE 2.7 Å, Cryo-EM structure of human full-length synaptic alpha1beta3gamma2 GABA(A)R in complex…
9FG7 2.7 Å, Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in complex with…

Browse structure collections

About this viewer

MolViewer shows 9FAN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.