CryoEM structure of gamma2 subunit of GABA(A)R in complex with GARLH4, the TMD of Neuroligin2 from a closed state, obtained by focused refinement. Determined by electron microscopy at 2.9 Å resolution. Released 2 Jul 2025.
Explore 9FAR in 3D Show helices and sheets RCSB PDB PDBe
9FAR contains 12 α-helices and 9 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 375-378 | 4 | |
| α-helix | 402-423 | 22 | |
| α-helix | 424-428 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 673-698 | 26 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-42 | 31 | |
| β-strand | 47-48 | 2 | 1 |
| β-strand | 57-59 | 3 | 1 |
| β-strand | 64-66 | 3 | 1 |
| β-strand | 76-78 | 3 | 1 |
| β-strand | 80 | 1 | 2 |
| β-strand | 83 | 1 | 2 |
| α-helix | 84-86 | 3 | |
| α-helix | 90-112 | 23 | |
| α-helix | 113-116 | 4 | |
| α-helix | 121-145 | 25 | |
| α-helix | 146-151 | 6 | |
| α-helix | 153-159 | 7 | |
| β-strand | 164 | 1 | 3 |
| β-strand | 167 | 1 | 3 |
| β-strand | 172-173 | 2 | 1 |
| α-helix | 175-202 | 28 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Isoform 2 of Gamma-aminobutyric acid receptor subunit gamma-2 | C | protein | 61 | Homo sapiens | P18507 (AlphaFold model) |
| Neuroligin-2 | H | protein | 33 | Homo sapiens | Q8NFZ4 (AlphaFold model) |
| LHFPL tetraspan subfamily member 4 protein | L | protein | 193 | Homo sapiens | Q7Z7J7 (AlphaFold model) |
>9FAR_1 Isoform 2 of Gamma-aminobutyric acid receptor subunit gamma-2 (chains C) CLDGKDCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL G
>9FAR_2 Neuroligin-2 (chains H) DSRDYSTELSVTVAVGASLLFLNILAFAALYYK
>9FAR_3 LHFPL tetraspan subfamily member 4 protein (chains L) YHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFGLFHYCVGSGL AGRELTCRGSFTDFSTIPSSAFKAAAFFVLLSMVLILGCITCFSLFFFCNTATVYKICAW MQLLAALCLVLGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILAIIGILNALIL SFLAFVLGNRQTD
| ID | Name | Formula | Copies |
|---|---|---|---|
| PLM | Palmitic acid | C16 H32 O2 | 1 |
| CLR | Cholesterol | C27 H46 O | 1 |
| D10 | Decane | C10 H22 | 1 |
| PGW | (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexade… | C40 H77 O10 P | 1 |
Water and common crystallization additives (CL) are not listed.
CryoEM structure of gamma2 subunit of GABA(A)R in complex with GARLH4, the TMD of Neuroligin2 from a closed state, obtained by focused refinement. Kasaragod, V.B., Aricescu, A.R. To be published.
Other PDB entries of the same protein (UniProt P18507 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9FAR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.