9FES: Mcherry

Name: PDB 9FES: mCherry - Directionality of Optical Properties of Fluorescent Proteins
Published: 2025-06-04
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

mCherry - Directionality of Optical Properties of Fluorescent Proteins. Determined by X-ray diffraction at 1.66 Å resolution. Released 4 Jun 2025.

Method: X-ray diffraction
Resolution: 1.66 Å
Organism: Discosoma
Chains: 1
Atoms: 1,832
Mol. weight: 30.63 kDa
Released: 4 Jun 2025

Explore 9FES in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9FES contains 7 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-22	11	1
β-strand	25-36	12	1
β-strand	41-50	10	1
α-helix	52	1
α-helix	54	1
α-helix	58-60	3
α-helix	62-64	3
β-strand	74	1	1
α-helix	82-85	4
β-strand	91-99	9	1
β-strand	104-114	11	1
β-strand	117-127	11	1
β-strand	140-143	4	1
α-helix	144-145	2
β-strand	146-153	8	1
β-strand	156-167	12	1
β-strand	172-183	12	1
α-helix	188-190	3
β-strand	193-204	12	1
β-strand	210-221	12	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mcherry	A	protein	269	Discosoma	Q9U6Y8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9FES_1 MCHERRY (chains A)
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPATMVSKGEEDNMAIIKEFMRFKVHMEG
SVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIP
DYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKT
MGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLD
ITSHNEDYTIVEQYERAEGRHSTGGMDELYT

Primary citation

Directionality of Optical Properties of Fluorescent Proteins. Myskova, J., Brynda, J., Khoroshyy, P. et al. To be published.

Other PDB entries of the same protein (UniProt Q9U6Y8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2H5O 1.08 Å, Crystal structure of mOrange
8B7G 1.3 Å, Structure of oxygen-degraded rsCherry
7ZCT 1.33 Å, Structure of the red fluorescent protein mScarlet3 at pH 7.5
9LSC 1.38 Å, Crystal structure of mRFP1 with a grafted calcium-binding sequence and two bound calcium…
1ZGO 1.4 Å, High Resolution Crystal Structure of the Discosoma Red Fluorescent Protein (DsRed)
7OIN 1.4 Å, Crystal structure of LSSmScarlet - a genetically encoded red fluorescent protein with a…
8ARM 1.41 Å, Crystal structure of LSSmScarlet2
8ZXH 1.46 Å, Structure of the red fluorescent protein mScarlet3-H at pH 4.5
5LK4 1.47 Å, Structure of the Red Fluorescent Protein mScarlet at pH 7.8
8B65 1.55 Å, Structure of rsCherry crystallized in anaerobic conditions
2VAD 1.59 Å, Monomeric red fluorescent protein, DsRed.M1
2H5R 1.6 Å, Crystal structure of mStrawberry at pH 10.5

Browse structure collections

About this viewer

MolViewer shows 9FES directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.