Crystal structure of human triose phosphate isomerase with glycerol-3-phosphate ligand. Determined by X-ray diffraction at 1.25 Å resolution. Released 12 Mar 2025.
Explore 9FFC in 3D Show helices and sheets RCSB PDB PDBe
9FFC contains 17 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-6 | 2 | |
| β-strand | 7-12 | 6 | 1 |
| α-helix | 19-31 | 13 | |
| α-helix | 34-35 | 2 | |
| β-strand | 38-43 | 6 | 1 |
| α-helix | 46-48 | 3 | |
| α-helix | 49-55 | 7 | |
| β-strand | 61-64 | 4 | 1 |
| α-helix | 81-86 | 6 | |
| β-strand | 91-94 | 4 | 1 |
| α-helix | 97-101 | 5 | |
| α-helix | 107-119 | 13 | |
| β-strand | 123-128 | 6 | 1 |
| α-helix | 132-136 | 5 | |
| α-helix | 140-152 | 13 | |
| α-helix | 158-160 | 3 | |
| β-strand | 161-165 | 5 | 1 |
| α-helix | 168-170 | 3 | |
| α-helix | 179-196 | 18 | |
| α-helix | 199-204 | 6 | |
| β-strand | 207-209 | 3 | 1 |
| α-helix | 218-222 | 5 | |
| β-strand | 229-232 | 4 | 1 |
| α-helix | 234-237 | 4 | |
| α-helix | 240-245 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Triosephosphate isomerase | A | protein | 249 | Homo sapiens | P60174 (AlphaFold model) |
>9FFC_1 Triosephosphate isomerase (chains A) MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAE GLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ QAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE FVDIINAKQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| G3P | Sn-glycerol-3-phosphate | C3 H9 O6 P | 1 |
Water and common crystallization additives (BR) are not listed.
Human glycolysis isomerases are inhibited by weak metabolite modulators. Jonatansdottir, Y.Y., Rolfsson, O., Hjorleifsson, J.G. FEBS J (2025) 292:3180-3204. DOI 10.1111/febs.70049 · PubMed
Other PDB entries of the same protein (UniProt P60174 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9FFC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.