9FT9: Bipartite JNK1-JIP1 complex

Structure of the bipartite JNK1-JIP1 complex. Determined by X-ray diffraction at 2.35 Å resolution. Released 5 Feb 2025.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,221
Mol. weight: 46.64 kDa
Ligands: ANP
Released: 5 Feb 2025

Explore 9FT9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9FT9 contains 25 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	1
β-strand	18-23	6	1
β-strand	26-35	10	2
β-strand	38-45	8	2
β-strand	50-58	9	2
α-helix	60-62	3
α-helix	64-79	16
β-strand	85	1	3
α-helix	86-87	2
β-strand	88-92	5	2
β-strand	103-109	7	2
β-strand	113-114	2	3
α-helix	116-120	5
α-helix	122-123	2
α-helix	125-143	19
β-strand	148	1	4
α-helix	154-156	3
β-strand	157-159	3	3
β-strand	165-167	3	3
β-strand	174	1	4
α-helix	182-185	4
α-helix	194-198	5
α-helix	206-220	15
α-helix	230-241	12
α-helix	243-245	3
α-helix	246-250	5
α-helix	254-261	8
α-helix	271-274	4
α-helix	277-279	3
α-helix	291-301	11
α-helix	306-308	3
α-helix	310-311	2
α-helix	312-316	5
α-helix	319-322	4
α-helix	327-330	4
α-helix	332-335	4
α-helix	349-362	14

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	158-161	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 1 of Mitogen-activated protein kinase 8	A	protein	360	Homo sapiens	P45983 (AlphaFold model)
C-Jun-amino-terminal kinase-interacting protein 1	B	protein	38	Homo sapiens

Sequence of entity 1 (A), FASTA

>9FT9_1 Isoform 1 of Mitogen-activated protein kinase 8 (chains A)
KRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQ
THAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELD
HERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTP
YVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTP
CPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVI
DASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLE

Sequence of entity 2 (B), FASTA

>9FT9_2 C-Jun-amino-terminal kinase-interacting protein 1 (chains B)
RPKRPTTLNLFPQVPRSQDKHSWQDRVSRSICLSDELP

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1

Primary citation

Bipartite binding of the intrinsically disordered scaffold protein JIP1 to the kinase JNK1. Orand, T., Delaforge, E., Lee, A. et al. Proc Natl Acad Sci U S A (2025) 122:e2419915122-e2419915122. DOI 10.1073/pnas.2419915122 · PubMed

Other PDB entries of the same protein (UniProt P45983 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XRW 1.33 Å, Linear binding motifs for JNK and for calcineurin antagonistically control the nuclear…
12CV 1.5 Å, Crystal Structure of human JNK1 Kinase Domain in complex with inhibitor CCD-2728
4QTD 1.5 Å, Structure of human JNK1 in complex with SCH772984 and the AMPPNP-hydrolysed triphosphate…
11ZL 1.55 Å, Crystal Structure of human JNK1 Kinase Domain in complex with inhibitor CCD-3013
8R5E 1.7 Å, JNK1 covalently bound to RU77 cyclohexenone based inhibitor
3ELJ 1.8 Å, Jnk1 complexed with a bis-anilino-pyrrolopyrimidine inhibitor.
4AWI 1.91 Å, Human Jnk1alpha kinase with 4-phenyl-7-azaindole IKK2 inhibitor.
4L7F 1.95 Å, Co-crystal Structure of JNK1 and AX13587
3PZE 2.0 Å, JNK1 in complex with inhibitor
8X5M 2.0 Å, The Crystal Structure of JNK1 from Biortus.
4HYU 2.15 Å, Crystal structure of JNK1 in complex with JIP1 peptide and…
4E73 2.27 Å, Crystal structure of JNK1beta-JIP in complex with an azaquinolone inhbitor

Browse structure collections

About this viewer

MolViewer shows 9FT9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.