9GBZ: 5'-lobe of the substrate-bound U11 snRNP

5'-lobe of the substrate-bound U11 snRNP. Determined by electron microscopy at 3.4 Å resolution. Released 5 Feb 2025.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,251
Mol. weight: 91.68 kDa
Released: 5 Feb 2025

Explore 9GBZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9GBZ contains 10 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	3-12	10
α-helix	15-17	3
α-helix	26-37	12
β-strand	40-46	7	1
β-strand	52-58	7	1
β-strand	62	1	2
α-helix	63-81	19
α-helix	89-95	7
β-strand	98-99	2	3
β-strand	104-105	2	3
β-strand	111	1	2
β-strand	122-123	2	1
β-strand	124	1	3

Chain C: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	13-17	5
α-helix	29-36	8
β-strand	52-56	5	4
α-helix	64-72	9
β-strand	77-84	8	4
β-strand	91-99	9	4
α-helix	102-110	9
β-strand	118	1	5
β-strand	120	1	5
β-strand	123-126	4	4
α-helix	138-140	3
β-strand	145	1	6
β-strand	154	1	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
U11/U12 small nuclear ribonucleoprotein 25 kDa protein	B	protein	132	Homo sapiens	Q9BV90 (AlphaFold model)
U11/U12 small nuclear ribonucleoprotein 35 kDa protein	C	protein	246	Homo sapiens	Q16560 (AlphaFold model)
P120-5'SS	G	RNA	11	Homo sapiens
U11 snRNA	R	RNA	135	Homo sapiens

Sequence of entity 1 (B), FASTA

>9GBZ_1 U11/U12 small nuclear ribonucleoprotein 25 kDa protein (chains B)
MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQS
ATVLDLKKAIQRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNR
DEVSFIKKLRQK

Sequence of entity 2 (C), FASTA

>9GBZ_2 U11/U12 small nuclear ribonucleoprotein 35 kDa protein (chains C)
MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNL
QTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVIDQH
EIFVDYELERTLKGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGK
RERRERSRSRERHWDSRTRDRDHDRGREKRWQEREPTRVWPDNDWERERDFRDDRIKGRE
KKERGK

Sequence of entity 3 (G), FASTA

>9GBZ_3 P120-5'SS (chains G)
AUAUCCUUUUU

Sequence of entity 4 (R), FASTA

>9GBZ_4 U11 snRNA (chains R)
AAAAAGGGCUUCUGUCGUGAGUGGCACACGUAGGGCAACUCGAUUGCUCUGCGUGCGGAA
UCGACAUCAAGAGAUUUCGGAAGCAUAAUUUUUUGGUAUUUGGGCAGCUGGUGAUCGUUG
GUCCCGGCGCCCUUU

Primary citation

Structural basis of 5' splice site recognition by the minor spliceosome. Zhao, J., Peter, D., Brandina, I. et al. Mol Cell (2025) 85:652. DOI 10.1016/j.molcel.2024.12.017 · PubMed

Other PDB entries of the same protein (UniProt Q9BV90 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GCM 3.1 Å, Structure of the U11 snRNP core
8Y6O 3.38 Å, Cryo-EM Structure of the human minor pre-B complex (pre-precatalytic spliceosome) U11…
8R7N 3.4 Å, Overall structure of the U11 snRNP
9GBW 3.5 Å, Overall structure of the substrate-bound U11 snRNP

Browse structure collections

About this viewer

MolViewer shows 9GBZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.