hRAR alpha LBD-AM580 complex with staple peptide. Determined by X-ray diffraction at 2.1 Å resolution. Released 12 Feb 2025.
Explore 9GFI in 3D Show helices and sheets RCSB PDB PDBe
9GFI contains 16 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 182-196 | 15 | |
| α-helix | 202-204 | 3 | |
| β-strand | 208 | 1 | 1 |
| α-helix | 222-244 | 23 | |
| α-helix | 249-251 | 3 | |
| α-helix | 254-275 | 22 | |
| β-strand | 277-278 | 2 | 2 |
| β-strand | 283-285 | 3 | 2 |
| β-strand | 290 | 1 | 1 |
| β-strand | 291-293 | 3 | 2 |
| α-helix | 294-297 | 4 | |
| α-helix | 298-302 | 5 | |
| α-helix | 303-305 | 3 | |
| α-helix | 306-316 | 11 | |
| α-helix | 317-319 | 3 | |
| α-helix | 323-334 | 12 | |
| α-helix | 345-366 | 22 | |
| α-helix | 373-401 | 29 | |
| α-helix | 405-407 | 3 | |
| α-helix | 408-414 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-8 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Retinoic acid receptor alpha | A | protein | 236 | Homo sapiens | P10276 (AlphaFold model) |
| Stapled peptide-like ligand | B | protein | 10 | synthetic construct |
>9GFI_1 Retinoic acid receptor alpha (chains A) LTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKT VEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHN AGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEAL KVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLE
>9GFI_2 Stapled peptide-like ligand (chains B) HKILLRLLRX
| ID | Name | Formula | Copies |
|---|---|---|---|
| EQN | 4-{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino}benzo… | C22 H25 N O3 | 1 |
Guanidinium-Stapled Helical Peptides for Targeting Protein-Protein Interactions. Perdriau, C., Luton, A., Zimmeter, K. et al. Angew Chem Int Ed Engl (2025) 64:e202416348-e202416348. DOI 10.1002/anie.202416348 · PubMed
Other PDB entries of the same protein (UniProt P10276 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9GFI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.