9GHI: Machupo virus GP1-GP2 heterodimer

Machupo virus GP1-GP2 heterodimer in complex with Fab of MAC1. Determined by X-ray diffraction at 2.41 Å resolution. Released 11 Jun 2025.

Method: X-ray diffraction
Resolution: 2.41 Å
Organisms: Mammarenavirus machupoense, Mus musculus
Chains: 4
Atoms: 6,422
Mol. weight: 99.53 kDa
Ligands: NAG
Released: 11 Jun 2025

Explore 9GHI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9GHI contains 35 α-helices and 64 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	63	1	1
β-strand	68-74	7	1
β-strand	75	1	2
α-helix	78-81	4
β-strand	90-93	4	3
β-strand	98-103	6	3
β-strand	106-113	8	3
β-strand	124-126	3	3
α-helix	129-134	6
α-helix	139-152	14
α-helix	160-161	2
β-strand	162-164	3	3
β-strand	175-178	4	3
α-helix	183-185	3
α-helix	186-199	14
α-helix	207-208	2
β-strand	214-219	6	3
β-strand	220	1	4
β-strand	222	1	4
α-helix	223-225	3
α-helix	231-234	4
α-helix	241-250	10

Chain B: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	282-283	2	5
α-helix	285-287	3
β-strand	288	1	2
β-strand	294-295	2	5
α-helix	298-305	8
α-helix	311-324	14
α-helix	344-346	3
α-helix	350-361	12
β-strand	366	1	6
β-strand	371-377	7	1
β-strand	383	1	1
α-helix	384-386	3
β-strand	387-388	2	1
β-strand	391-392	2	6
β-strand	395-396	2	6
α-helix	397-398	2
α-helix	399-402	4
α-helix	403-425	23

Chain H: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	7
β-strand	10-12	3	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	34-39	6	8
β-strand	45-51	7	8
β-strand	57-59	3	8
β-strand	64	1	7
β-strand	67-72	6	7
β-strand	77-82	6	7
α-helix	84-86	3
β-strand	88-95	8	8
α-helix	96	1
β-strand	100C-103	4	8
β-strand	107-111	5	8
α-helix	114-116	3
β-strand	117	1	9
α-helix	118-119	2
β-strand	120-124	5	10
β-strand	135-145	11	10
β-strand	146	1	9
β-strand	151-154	4	11
α-helix	155-157	3
β-strand	163-165	3	10
α-helix	166-168	3
β-strand	169-171	3	10
β-strand	174-184	11	10
β-strand	193-199	7	11
α-helix	200-202	3
β-strand	204-210	7	11

Chain L: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	12
β-strand	10-13	4	8
β-strand	19-25	7	12
β-strand	33-38	6	8
β-strand	44-49	6	8
β-strand	53-54	2	8
α-helix	55	1
β-strand	62-67	6	12
β-strand	70-75	6	12
α-helix	80-82	3
β-strand	85-90	6	8
α-helix	96	1
β-strand	97-98	2	8
β-strand	102-106	5	8
β-strand	111	1	13
β-strand	114-118	5	14
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	14
β-strand	140	1	13
β-strand	144-150	7	15
β-strand	153-155	3	15
β-strand	159-163	5	14
α-helix	164-167	4
β-strand	173-182	10	14
α-helix	183-187	5
β-strand	191-198	8	15
β-strand	201-210	10	15
α-helix	211-213	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pre-glycoprotein polyprotein GP complex	A	protein	204	Mammarenavirus machupoense	Q6IUF7
Glycoprotein G2	B	protein	204	Mammarenavirus machupoense	Q6IUF7
MAC1 heavy chain	H	protein	234	Mus musculus
MAC1 light chain	L	protein	217	Mus musculus

Sequence of entity 1 (A), FASTA

>9GHI_1 Pre-glycoprotein polyprotein GP complex (chains A)
DGTFKIGLHTEFQSVTLTMQRLLANHSNECPSLCMLNNSFYYMRGGVNTFLIRVSDISVL
MKEYDVSIYEPEDLGNCLNASDSSWAIHWFSNALGHDWLMDPPMLCRNKTKKEGSNIQFN
ISKADDARVYGKKIRNGMRHLFRGFHDPCEEGKVCYLTINQCGDPSSFEYCGVNHLSKCQ
FDHVNTLHFLVRSKTHLNFSRRKR

Sequence of entity 2 (B), FASTA

>9GHI_2 Glycoprotein G2 (chains B)
SFFSWSLTDSSGKDMPGGYCLEEWMLIAAKMKCFGNTAVAKCNQDHDSEFCDMLRLFDYN
KNAIKTLNDPSKKEINLCSQTVNALISDNLLMKNKIKELMSIPYCNYTKFWYVNHTLTGQ
HTLPRCWLIRNGSYLNTSEFRNDWILESDHLISEMLSKEYAERQGKSGDDDDKGSGWSHP
QFEKGGGSGGGSGGSAWSHPQFEK

Sequence of entity 3 (H), FASTA

>9GHI_3 MAC1 heavy chain (chains H)
ETGQVQLQQSGAELVKPGASVKISCKASGYAFGSHWMNWVKQRPGKGLEWIGQIYPGDGD
TNYNGKFKGKATLTADKSSSTAYMQFSSLTSEDSAVYFCARDDYGTRYYFDYWGQGTTLT
VSSATTKGPSVYPLAPSAAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVL
QSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRDCGTKHHHHHH

Sequence of entity 4 (L), FASTA

>9GHI_4 MAC1 light chain (chains L)
ETGDIQMTQTTSSLSASLGDRVSISCRASQDINNYLNWYQQKPDGTVKLLIHYTSRLRSG
VPSRFSGSGFGTDYSLTITNLEQEDIATYFCQQGKTLPLTFGAGTKLEIKRTDAAPTVSI
FPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSS
TLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Structure and stabilization of the antigenic glycoprotein building blocks of the New World mammarenavirus spike complex. Paesen, G.C., Ng, W.M., Kimuda, S. et al. mBio (2025) 16:e0107625-e0107625. DOI 10.1128/mbio.01076-25 · PubMed

Other PDB entries of the same protein (UniProt Q6IUF7), best resolution first:

9MT2 2.9 Å, Structure of the Machupo virus glycoprotein complex

Browse structure collections

About this viewer

MolViewer shows 9GHI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.