9GIG: NMDA

NMDA bound to compound 387. Determined by X-ray diffraction at 2.09 Å resolution. Released 27 Nov 2024.

Method: X-ray diffraction
Resolution: 2.09 Å
Organisms: Rattus norvegicus, Homo sapiens
Chains: 2
Atoms: 4,414
Mol. weight: 65.69 kDa
Ligands: A1ILO, GLU
Released: 27 Nov 2024

Explore 9GIG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9GIG contains 31 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	405-410	6	1
β-strand	413	1	2
β-strand	417	1	2
β-strand	418-421	4	1
β-strand	423	1	3
β-strand	428	1	3
α-helix	429-430	2
β-strand	434-441	8	1
β-strand	449-457	9	1
α-helix	459-471	13
β-strand	474-479	6	1
β-strand	488-489	2	4
β-strand	492-493	2	4
α-helix	495-501	7
β-strand	507-508	2	1
β-strand	513	1	5
α-helix	516-519	4
β-strand	523-524	2	1
β-strand	529-538	10	5
α-helix	668-671	4
α-helix	673-675	3
α-helix	679-680	2
β-strand	682-683	2	5
α-helix	689-697	9
α-helix	699-705	7
α-helix	706-708	3
α-helix	713-721	9
β-strand	727-731	5	5
α-helix	732-740	9
α-helix	743-745	3
β-strand	747-749	3	5
β-strand	756-761	6	5
β-strand	764-765	2	1
α-helix	772-785	14
α-helix	787-796	10

Chain B: 16 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	398-402	5	6
β-strand	405	1	7
β-strand	409	1	7
β-strand	410-413	4	6
α-helix	420-422	3
β-strand	424	1	8
β-strand	430	1	8
β-strand	434-438	5	6
β-strand	451-456	6	6
α-helix	458-470	13
β-strand	474-478	5	6
β-strand	487-489	3	9
β-strand	496-498	3	9
α-helix	500-507	8
β-strand	512-513	2	6
α-helix	517	1
β-strand	518	1	10
α-helix	519	1
α-helix	521-524	4
β-strand	528-529	2	6
α-helix	530	1
α-helix	532	1
β-strand	534-543	10	10
α-helix	670-673	4
β-strand	676	1	11
β-strand	679	1	11
β-strand	681-682	2	10
β-strand	684	1	12
α-helix	688-695	8
α-helix	697-699	3
α-helix	700-706	7
β-strand	711	1	12
α-helix	714-722	9
β-strand	728-732	5	10
α-helix	733-742	10
β-strand	746-758	13	10
β-strand	761-762	2	6
α-helix	769-781	13
α-helix	784-792	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate receptor	A	protein	285	Rattus norvegicus	Q00959 (AlphaFold model)
Isoform 1 of Glutamate receptor ionotropic, NMDA 1	B	protein	291	Homo sapiens	Q05586 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9GIG_1 Glutamate receptor (chains A)
GSPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKG
FCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEER
SEVVDFSVPFVETGISVMVSRGTQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNN
YPYMHQYMTRFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFA
TTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHN

Sequence of entity 2 (B), FASTA

>9GIG_2 Isoform 1 of Glutamate receptor ionotropic, NMDA 1 (chains B)
MSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQ
CCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMI
VAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSV
DIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTT
GELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDS

Ligands and cofactors

ID	Name	Formula	Copies
A1ILO	(2~{R})-2-azanyl-3-[[3-(5-ethyl-3-methyl-1,2-oxazol-4-yl)-5-fluoranyl-phenyl]ca…	C16 H18 F N3 O4	1
GLU	Glutamic acid	C5 H9 N O4	1

Primary citation

Advancements in NMDA Receptor-Targeted Antidepressants: From d-Cycloserine Discovery to Preclinical Efficacy of Lu AF90103. Ascic, E., Marigo, M., David, L. et al. J Med Chem (2024) 67:20135-20155. DOI 10.1021/acs.jmedchem.4c01477 · PubMed

Other PDB entries of the same protein (UniProt Q00959 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JWX 1.5 Å, GluN2A ligand-binding core in complex with propyl-NHP5G
5U8C 1.6 Å, Crystal structure of GLUN1/GLUN2A ligand-binding domain in complex with glycine and…
9GJ1 1.62 Å, NMDA bound to compound 339
6UZ6 1.66 Å, Crystal structure of GLUN1/GLUN2A-4M mutant ligand-binding domain in complex with…
2A5S 1.7 Å, Crystal Structure Of The NR2A Ligand Binding Core In Complex With Glutamate
5I57 1.7 Å, Glutamate- and glycine-bound GluN1/GluN2A agonist binding domains
9NYZ 1.71 Å, Crystal structure of DCKA/glutamate-bound GluN1/GluN2A agonist binding domains with…
4NF8 1.86 Å, Crystal structure of GluN1/GluN2A ligand-binding domain in complex with glycine and…
6UZR 1.87 Å, Crystal structure of GLUN1/GLUN2A ligand-binding domain in complex with glycine and…
4NF5 1.9 Å, Crystal structure of GluN1/GluN2A ligand-binding domain in complex with glycine and D-AP5
6UZG 1.94 Å, Crystal structure of GLUN1/GLUN2A-4M mutant ligand-binding domain in complex with…
9GIB 1.95 Å, NMDA bound to compound 380

Browse structure collections

About this viewer

MolViewer shows 9GIG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.