Jumonji domain-containing protein 2A with crystallization epitope mutation R913A. Determined by X-ray diffraction at 1.7 Å resolution. Released 4 Sept 2024.
Explore 9GII in 3D Show helices and sheets RCSB PDB PDBe
9GII contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 904-908 | 5 | 1 |
| β-strand | 914-932 | 19 | 1 |
| β-strand | 937-941 | 5 | 1 |
| α-helix | 943-945 | 3 | |
| β-strand | 946 | 1 | 1 |
| α-helix | 951-954 | 4 | |
| α-helix | 956-958 | 3 | |
| β-strand | 962-966 | 5 | 1 |
| β-strand | 972-989 | 18 | 1 |
| β-strand | 995-998 | 4 | 1 |
| α-helix | 1000-1002 | 3 | |
| β-strand | 1004 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lysine-specific demethylase 4A | A | protein | 117 | Homo sapiens | O75164 (AlphaFold model) |
>9GII_1 Lysine-specific demethylase 4A (chains A) SMQSITAGQKVISKHKNGAFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQF GPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP
A fast, parallel method for efficiently exploring crystallization behaviour of large numbers of protein variants. Fairhead, M., Strain-Damerell, C., Ye, M. et al. To be published.
Other PDB entries of the same protein (UniProt O75164 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9GII directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.