Crystal Structure of Human UBC9 C93E. Determined by X-ray diffraction at 1.72 Å resolution. Released 7 May 2025.
Explore 9GLR in 3D Show helices and sheets RCSB PDB PDBe
9GLR contains 9 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-18 | 16 | |
| β-strand | 25-30 | 6 | 1 |
| α-helix | 31 | 1 | |
| β-strand | 36-46 | 11 | 1 |
| α-helix | 47-48 | 2 | |
| β-strand | 57-63 | 7 | 1 |
| α-helix | 72-73 | 2 | |
| β-strand | 74-77 | 4 | 1 |
| α-helix | 80-81 | 2 | |
| β-strand | 86 | 1 | 2 |
| β-strand | 91 | 1 | 1 |
| β-strand | 92 | 1 | 2 |
| α-helix | 95-97 | 3 | |
| α-helix | 109-121 | 13 | |
| α-helix | 131-139 | 9 | |
| α-helix | 141-154 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SUMO-conjugating enzyme UBC9 | AAA | protein | 159 | Homo sapiens | P63279 (AlphaFold model) |
>9GLR_1 SUMO-conjugating enzyme UBC9 (chains AAA) GMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFK LRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVELSILEEDKDWRPAITIKQILLGIQEL LNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS
UFC1 reveals the multifactorial and plastic nature of oxyanion holes in E2 conjugating enzymes. Kumar, M., Banerjee, S., Cohen-Kfir, E. et al. Nat Commun (2025) 16:3912-3912. DOI 10.1038/s41467-025-58826-y · PubMed
Other PDB entries of the same protein (UniProt P63279 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9GLR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.