9GLX: NRas-Q61R-GTP
NRas-Q61R-GTP in complex with the peptide MPB3. Determined by X-ray diffraction at 1.85 Å resolution. Released 10 Dec 2025.
- Method
- X-ray diffraction
- Resolution
- 1.85 Å
- Organisms
- Homo sapiens, synthetic construct
- Chains
- 16
- Atoms
- 10,526
- Mol. weight
- 137.49 kDa
- Ligands
- GTP, MG
- Released
- 10 Dec 2025
Explore 9GLX in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9GLX contains 42 α-helices and 48 β-strands across 13 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A and F: 6 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-9 | 8 | 1 |
| α-helix | 16-25 | 10 | |
| β-strand | 37-46 | 10 | 1 |
| β-strand | 49-58 | 10 | 1 |
| α-helix | 62-67 | 6 | |
| α-helix | 68-74 | 7 | |
| β-strand | 77-83 | 7 | 1 |
| α-helix | 87-104 | 18 | |
| β-strand | 111-116 | 6 | 1 |
| α-helix | 127-137 | 11 | |
| β-strand | 141-143 | 3 | 1 |
| α-helix | 152-167 | 16 | |
Chain B: 6 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-9 | 8 | 1 |
| α-helix | 16-25 | 10 | |
| β-strand | 37-46 | 10 | 1 |
| β-strand | 49-58 | 10 | 1 |
| α-helix | 62-67 | 6 | |
| α-helix | 68-74 | 7 | |
| β-strand | 77-83 | 7 | 1 |
| α-helix | 87-103 | 17 | |
| β-strand | 111-116 | 6 | 1 |
| α-helix | 127-137 | 11 | |
| β-strand | 141-143 | 3 | 1 |
| α-helix | 152-167 | 16 | |
Chains C and D: 6 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-9 | 8 | 2 |
| α-helix | 16-25 | 10 | |
| β-strand | 37-46 | 10 | 2 |
| β-strand | 49-58 | 10 | 2 |
| α-helix | 62-67 | 6 | |
| α-helix | 68-74 | 7 | |
| β-strand | 77-83 | 7 | 2 |
| α-helix | 87-104 | 18 | |
| β-strand | 111-116 | 6 | 2 |
| α-helix | 127-137 | 11 | |
| β-strand | 141-143 | 3 | 2 |
| α-helix | 152-166 | 15 | |
Chain E: 7 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-9 | 8 | 3 |
| α-helix | 16-25 | 10 | |
| β-strand | 37-46 | 10 | 3 |
| β-strand | 49-58 | 10 | 3 |
| α-helix | 62-67 | 6 | |
| α-helix | 68-74 | 7 | |
| β-strand | 77-83 | 7 | 3 |
| α-helix | 87-91 | 5 | |
| α-helix | 93-104 | 12 | |
| β-strand | 111-116 | 6 | 3 |
| α-helix | 127-137 | 11 | |
| β-strand | 141-144 | 4 | 3 |
| α-helix | 152-166 | 15 | |
Chains Q, T, U and W: 1 helix, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-3 | 2 | 1 |
| α-helix | 8 | 1 | |
| β-strand | 13 | 1 | 1 |
Chains R and V: 0 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 13 | 1 | 1 |
Chain S: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10-12 | 3 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| GTPase NRas | A, B, C, D, E, F | protein | 171 | Homo sapiens | P01111 (AlphaFold model) |
| peptide MPB3 | G, K, N, Q, R, S, T, U, V, W | protein | 16 | synthetic construct | |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>9GLX_1 GTPase NRas (chains A, B, C, D, E, F)
GPMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDT
AGREEYSAMRDQYMRTGEGFLLVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKS
DLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMK
Sequence of entity 2 (G, K, N, Q, R, S, T, U, V, W), FASTA
>9GLX_2 peptide MPB3 (chains G, K, N, Q, R, S, T, U, V, W)
FIYWPWADLGVPDCGX
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| GTP | Guanosine-5'-triphosphate | C10 H16 N5 O14 P3 | 6 |
| MG | Magnesium ion | Mg | 6 |
Primary citation
Identification and characterization of binders to a cryptic and functional pocket in KRAS. Beyer, K.S., Klein, J., Katz, S. et al. Nat Commun (2025) 16:10836-10836. DOI 10.1038/s41467-025-65844-3 · PubMed
Other PDB entries of the same protein (UniProt P01111 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9BG8 1.2 Å, Tri-complex of Daraxonrasib (RMC-6236), NRAS Q61R, and CypA
- 24SR 1.23 Å, Human NRAS WT (GDP-bound) in complex with macrocyclic peptide inhibitor AP6296
- 7F68 1.24 Å, Crystal structure of N-ras S89D
- 9BG3 1.33 Å, Tri-complex of Daraxonrasib (RMC-6236), NRAS Q61K, and CypA
- 6ZIO 1.55 Å, Crystal structure of NRAS (C118S) in complex with GDP
- 9Y3W 1.56 Å, Crystal structure of NRas-G12D in complex with GDP and compound 13
- 8TBI 1.59 Å, Tricomplex of RMC-7977, NRAS WT, and CypA
- 9BG0 1.64 Å, Tri-complex of Daraxonrasib (RMC-6236), NRAS WT, and CypA
- 3CON 1.65 Å, Crystal structure of the human NRAS GTPase bound with GDP
- 6WGH 1.65 Å, Crystal structure of GDP-bound NRAS with ten residues long internal tandem duplication…
- 5UHV 1.67 Å, wild-type NRas bound to GppNHp
- 9Y1Y 1.7 Å, Crystal structure of NRas-G12D in complex with GDP and compound 7
Browse structure collections
About this viewer
MolViewer shows 9GLX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.