Structure of SENP5 in complex with SUMO2. Determined by X-ray diffraction at 2.36 Å resolution. Released 16 Jul 2025.
Explore 9GNN in 3D Show helices and sheets RCSB PDB PDBe
9GNN contains 28 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 571-574 | 4 | |
| α-helix | 575-577 | 3 | |
| α-helix | 581-583 | 3 | |
| β-strand | 584 | 1 | 1 |
| α-helix | 585-598 | 14 | |
| β-strand | 603-605 | 3 | 2 |
| α-helix | 610-622 | 13 | |
| α-helix | 623-626 | 4 | |
| α-helix | 631-633 | 3 | |
| β-strand | 636-642 | 7 | 2 |
| β-strand | 647-653 | 7 | 2 |
| β-strand | 658-662 | 5 | 2 |
| α-helix | 670-672 | 3 | |
| α-helix | 673-686 | 14 | |
| α-helix | 690-692 | 3 | |
| β-strand | 697-698 | 2 | 2 |
| α-helix | 699-701 | 3 | |
| α-helix | 705-707 | 3 | |
| α-helix | 713-725 | 13 | |
| α-helix | 734-736 | 3 | |
| α-helix | 737-750 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 571-575 | 5 | |
| α-helix | 581-583 | 3 | |
| β-strand | 584 | 1 | 3 |
| α-helix | 585-598 | 14 | |
| β-strand | 603-605 | 3 | 4 |
| α-helix | 610-622 | 13 | |
| α-helix | 623-626 | 4 | |
| β-strand | 636-643 | 8 | 4 |
| β-strand | 646-653 | 8 | 4 |
| β-strand | 658-662 | 5 | 4 |
| α-helix | 670-686 | 17 | |
| α-helix | 690-692 | 3 | |
| β-strand | 697-700 | 4 | 4 |
| α-helix | 713-726 | 14 | |
| α-helix | 734-736 | 3 | |
| α-helix | 737-750 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17-24 | 8 | 5 |
| β-strand | 29-35 | 7 | 5 |
| α-helix | 41-51 | 11 | |
| β-strand | 58-62 | 5 | 5 |
| β-strand | 65-66 | 2 | 5 |
| β-strand | 82-88 | 7 | 5 |
| β-strand | 91 | 1 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17-23 | 7 | 6 |
| β-strand | 29-35 | 7 | 6 |
| α-helix | 41-51 | 11 | |
| α-helix | 55-57 | 3 | |
| β-strand | 58-62 | 5 | 6 |
| β-strand | 65-66 | 2 | 6 |
| β-strand | 82-88 | 7 | 6 |
| β-strand | 91 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sentrin-specific protease 5 | A, B | protein | 207 | Homo sapiens | Q96HI0 (AlphaFold model) |
| Small ubiquitin-related modifier 3 | C, D | protein | 79 | Homo sapiens | P55854 (AlphaFold model) |
>9GNN_1 Sentrin-specific protease 5 (chains A, B) HHHHHHSSGLVPRGSHMASMLDMDDLATLDGQNWLNDQVINMYGELIMDAVPDKVHFFNS FFHRQLVTKGYNGVKRWTKKVDLFKKSLLLIPIHLEVHWSLITVTLSNRIISFYDSQGIH FKFCVENIRKYLLTEAREKNRPEFLQGWQTAVTKCIPQQKNDSDCGVFVLQYCKCLALEQ PFQFSQEDMPRVRKRIYKELCECRLMD
>9GNN_2 Small ubiquitin-related modifier 3 (chains C, D) MNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTP AQLEMEDEDTIDVFQQQTG
| ID | Name | Formula | Copies |
|---|---|---|---|
| AYE | prop-2-en-1-amine | C3 H7 N | 2 |
Structural basis for the human SENP5's SUMO isoform discrimination. Sanchez-Alba, L., Ying, L., Maletic, M.D. et al. Nat Commun (2025) 16:4764-4764. DOI 10.1038/s41467-025-60029-4 · PubMed
Other PDB entries of the same protein (UniProt Q96HI0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9GNN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.