9HCT: Human TRF1 TRFH domain

Crystal structure of human TRF1 TRFH domain in complex with compound 50. Determined by X-ray diffraction at 1.7 Å resolution. Released 19 Nov 2025.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,788
Mol. weight: 26.19 kDa
Ligands: CA, B0V
Released: 19 Nov 2025

Explore 9HCT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HCT contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	61-92	32
α-helix	95-110	16
α-helix	117-133	17
α-helix	150-158	9
α-helix	167-186	20
α-helix	190-200	11
α-helix	209-220	12
α-helix	227-230	4
α-helix	233-251	19
α-helix	255-266	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Telomeric repeat-binding factor 1	A	protein	224	Homo sapiens	P54274 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9HCT_1 Telomeric repeat-binding factor 1 (chains A)
SNAQVQVGAPEEEEEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNS
AEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKE
HDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTF
HSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKR

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1
B0V	2-methoxy-~{N}-(2,4,6-trimethylphenyl)ethanamide	C12 H17 N O2	1

Water and common crystallization additives (DMS, EDO) are not listed.

Primary citation

Discovery of first-in-class inhibitors of the TRF1:TIN2 protein:protein interaction by fragment screening. Casale, G., Liu, M., Le Bihan, Y.V. et al. Sci Rep (2025) 15:40922-40922. DOI 10.1038/s41598-025-23858-3 · PubMed

Other PDB entries of the same protein (UniProt P54274 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9HCZ 1.55 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 6
9HCX 1.69 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 53
9HCP 1.7 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 15
9HD1 1.73 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 59
9HCL 1.87 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 12
9HD9 1.87 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 1
9HF9 1.9 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 5
9HCN 1.93 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 46
9HCY 1.93 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 54
9HD0 1.93 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 55
9HCR 1.93 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 48
9HCQ 1.96 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 47

Browse structure collections

About this viewer

MolViewer shows 9HCT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.