9HI3: C-terminal domain of pectobacterial FusB

C-terminal domain of pectobacterial FusB in complex with spinach ferredoxin 1. Determined by X-ray diffraction at 1.7 Å resolution. Released 23 Apr 2025.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Pectobacterium carotovorum
Chains: 1
Atoms: 1,777
Mol. weight: 21.66 kDa
Ligands: NI, FES
Released: 23 Apr 2025

Explore 9HI3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HI3 contains 7 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	14-17	4	1
α-helix	24-29	6
β-strand	33-41	9	2
β-strand	47-56	10	2
α-helix	62-69	8
β-strand	73-75	3	1
β-strand	80-90	11	2
β-strand	94-100	7	2
α-helix	104-107	4
β-strand	115-122	8	3
β-strand	125-132	8	3
α-helix	137-142	6
β-strand	161-166	6	3
β-strand	169-170	2	4
α-helix	179-183	5
β-strand	186-188	3	3
α-helix	189-191	3
β-strand	193-194	2	4
β-strand	198-201	4	3
α-helix	205-209	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein TonB,Ferredoxin-1, chloroplastic	A	protein	198	Pectobacterium carotovorum	P00221 (AlphaFold model), Q6D8U5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9HI3_1 Protein TonB,Ferredoxin-1, chloroplastic (chains A)
FRALHRRVNYPSRAKALGVEGKVRVKFDITGSGTVTNVQVLSETPDGVFGDDVVKDMARW
RYRTEAPVENQVVSIVFKLNGHIRVDDQQGSAGSAGSAGSAAAYKVTLVTPTGNVEFQCP
DDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAA
YPVSDVTIETHKEEELTA

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	1
FES	FE2/S2 (inorganic) cluster	Fe2 S2	1

Water and common crystallization additives (K) are not listed.

Primary citation

Receptor-substrate competition for the TonB homolog FusB suggests a model for ferredoxin import. Wojnowska, M., Flores, V., Yelland, T. et al. J Biol Chem (2026) 302:113121-113121. DOI 10.1016/j.jbc.2026.113121 · PubMed

Other PDB entries of the same protein (UniProt P00221 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GYD 0.92 Å, Ferredoxin Wild-type -As-isolated state
9TXE 0.95 Å, Spinach Ferredoxin I, Oxidised
9GYN 1.0 Å, Ferredoxin Wild-type - Reduced state
9GYR 1.1 Å, Ferredoxin CNF labelled, oxidised state
9GYU 1.1 Å, Ferredoxin CNF-labelled reduced state
9TXQ 1.1 Å, Spinach Ferredoxin I, Reduced with Methyl Viologen at -450mV
29KI 1.11 Å, Spinach Ferredoxin I, Reduced, -400 mV
9GYL 1.19 Å, Ferredoxin Wild-type -Oxidised state
9TXO 1.2 Å, Spinach Ferredoxin I, Re-Oxidised
1A70 1.7 Å, Spinach ferredoxin

Browse structure collections

About this viewer

MolViewer shows 9HI3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.