Anti-HIV-1 chimeric miniprotein mimicking the N-terminal half of gp41 NHR with an extended region targeting the MPER. Determined by X-ray diffraction at 1.7 Å resolution. Released 30 Apr 2025.
Explore 9HS7 in 3D Show helices and sheets RCSB PDB PDBe
9HS7 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-41 | 34 | |
| α-helix | 47-84 | 38 | |
| α-helix | 97-127 | 31 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transmembrane protein gp41 | A | protein | 140 | Human immunodeficiency virus type 1 (BRU ISOLATE) | P19551 |
>9HS7_1 Transmembrane protein gp41 (chains A) MTCGAASMTKTVQARQKLSGIVQKQNNLLRKIEAIQHLLQRGLICGPQLLHQIAEIEREL NNQEQEIGSLKQRAQVEKTMSAASGCGMGPASMTLDVQARQLLSGIDQQQNNLKRAIEAI KHLLQLTCWGGGGSHHHHHH
Potent HIV-1 miniprotein inhibitors targeting highly conserved gp41 epitopes. Polo-Megias, D., Cano-Munoz, M., Gantner, P. et al. Int J Biol Macromol (2025) 310:143157-143157. DOI 10.1016/j.ijbiomac.2025.143157 · PubMed
Other PDB entries of the same protein (UniProt P19551), best resolution first:
MolViewer shows 9HS7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.