Crystal structure of the Pellino 1 FHA domain in complex with a MDC1-TQxF phosphopeptide. Determined by X-ray diffraction at 2.55 Å resolution. Released 5 Mar 2025.
Explore 9IF9 in 3D Show helices and sheets RCSB PDB PDBe
9IF9 contains 8 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 14-15 | 2 | |
| β-strand | 16-23 | 8 | 6 |
| α-helix | 24 | 1 | |
| α-helix | 29-30 | 2 | |
| β-strand | 40-44 | 5 | 6 |
| β-strand | 51-58 | 8 | 7 |
| α-helix | 63-70 | 8 | |
| β-strand | 75-80 | 6 | 7 |
| β-strand | 86-94 | 9 | 7 |
| β-strand | 97-103 | 7 | 8 |
| β-strand | 112-113 | 2 | 8 |
| β-strand | 139-144 | 6 | 8 |
| β-strand | 151-155 | 5 | 8 |
| β-strand | 163-166 | 4 | 7 |
| β-strand | 171-174 | 4 | 9 |
| β-strand | 180-183 | 4 | 9 |
| β-strand | 188-191 | 4 | 6 |
| β-strand | 207-209 | 3 | 6 |
| β-strand | 215-216 | 2 | 6 |
| α-helix | 217-219 | 3 | |
| α-helix | 229 | 1 | |
| β-strand | 230 | 1 | 6 |
| α-helix | 231 | 1 | |
| β-strand | 237 | 1 | 8 |
| β-strand | 242-245 | 4 | 6 |
| β-strand | 250-254 | 5 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 16-22 | 7 | 1 |
| β-strand | 40-44 | 5 | 1 |
| β-strand | 51-58 | 8 | 2 |
| α-helix | 63-70 | 8 | |
| β-strand | 75-82 | 8 | 2 |
| β-strand | 85-94 | 10 | 2 |
| β-strand | 97-103 | 7 | 3 |
| β-strand | 112-113 | 2 | 3 |
| β-strand | 139-144 | 6 | 3 |
| β-strand | 151-155 | 5 | 3 |
| β-strand | 163-166 | 4 | 2 |
| β-strand | 172-174 | 3 | 4 |
| β-strand | 180-182 | 3 | 4 |
| β-strand | 188-191 | 4 | 1 |
| β-strand | 194 | 1 | 5 |
| β-strand | 203 | 1 | 5 |
| β-strand | 207-209 | 3 | 1 |
| β-strand | 215-216 | 2 | 1 |
| β-strand | 230 | 1 | 1 |
| β-strand | 237 | 1 | 3 |
| β-strand | 243-245 | 3 | 1 |
| β-strand | 250-254 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase pellino homolog 1 | A, B | protein | 251 | Homo sapiens | Q96FA3 (AlphaFold model) |
| Mediator of DNA damage checkpoint protein 1 | C, D | protein | 11 | Homo sapiens | Q14676 (AlphaFold model) |
>9IF9_1 E3 ubiquitin-protein ligase pellino homolog 1 (chains A, B) APVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNK DQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQS TISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMH PRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLL WRTAEGLSHTP
>9IF9_2 Mediator of DNA damage checkpoint protein 1 (chains C, D) AYEDSETQPFD
MDC1 mediates Pellino recruitment to sites of DNA double-strand breaks. Torres Esteban, M., Stewart, M.J., Bragginton, E. et al. Life Sci Alliance (2025) 8. DOI 10.26508/lsa.202403074 · PubMed
MolViewer shows 9IF9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.