9JA6: Tdk1 tetramer complex

Cryo-EM structure of Tdk1 tetramer complex. Determined by electron microscopy at 4.4 Å resolution. Released 13 Nov 2024.

Method: Electron microscopy
Resolution: 4.4 Å
Organisms: Schizosaccharomyces pombe 972h-, Streptococcus sp. group G
Chains: 4
Atoms: 4,880
Mol. weight: 153.75 kDa
Released: 13 Nov 2024

Explore 9JA6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9JA6 contains 36 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	209-273	65
α-helix	289-291	3
α-helix	295-296	2
α-helix	300-304	5
α-helix	308-317	10
α-helix	327-329	3
α-helix	330-338	9
α-helix	343-347	5
α-helix	350-352	3

Chains B, C and D: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	209-273	65
α-helix	289-290	2
α-helix	295-296	2
α-helix	300-304	5
α-helix	308-317	10
α-helix	327-329	3
α-helix	330-338	9
α-helix	343-347	5
α-helix	350-352	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Meiotically up-regulated gene 135 protein,Immunoglobulin G-binding protein G	A, B, C, D	protein	332	Schizosaccharomyces pombe 972h-, Streptococcus sp. group G	O74876 (AlphaFold model), P06654 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>9JA6_1 Meiotically up-regulated gene 135 protein,Immunoglobulin G-binding protein G (chains A, B, C, D)
MSEEDNRLNELFANDLGVQPPCERSLKEGRRFLNDFEIAAKKKLLELERKALEDKEKNLN
FVVESERTLFNSKKRAFDNDECYNDRCKLFRGIVNEWGRSERTLDSLDEPPAWFRREMGE
WKKAREEDKEWRKSTDERLENLLNIVREILDVQRDMRNDLSNLTRKVDRMDMRLSRNNNM
IMRSFRQPITEVPFFNGDIPDPNLPRITRIEDIDSLSEENCTRYLKGYGVSYDENDQSLW
KRQLAKAVGLTAAYDASYTFSPFSSSESGGGSSGGGSTYKLILNGKTLKGETTTEAVDAA
TAEKVFKQYANDNGVDGEWTYDDATKTFTVTE

Primary citation

Structural duality enables a single protein to act as a toxin-antidote pair for meiotic drive. Hua, Y., Zhang, J., Yang, M.Y. et al. Proc Natl Acad Sci U S A (2024) 121:e2408618121-e2408618121. DOI 10.1073/pnas.2408618121 · PubMed

Other PDB entries of the same protein (UniProt O74876 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9JA5 2.7 Å, Cryo-EM structure of Tdk1-Bdf1 complex

Browse structure collections

About this viewer

MolViewer shows 9JA6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.