9KTO: Alpha-hemolysin
Alpha-hemolysin heptameric late pre-pore state with bound lipids derived from 10:0 PC/Sphingomyelin liposomes. Determined by electron microscopy at 2.6 Å resolution. Released 11 Jun 2025.
- Method
- Electron microscopy
- Resolution
- 2.6 Å
- Organism
- Staphylococcus aureus
- Chains
- 7
- Atoms
- 15,974
- Mol. weight
- 237 kDa
- Ligands
- P1O
- Released
- 11 Jun 2025
Explore 9KTO in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9KTO contains 35 α-helices and 194 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 28 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-5 | 4 | |
| β-strand | 7 | 1 | 2 |
| α-helix | 8 | 1 | |
| β-strand | 14 | 1 | 9 |
| β-strand | 21-22 | 2 | 10 |
| β-strand | 26-29 | 4 | 11 |
| β-strand | 34-37 | 4 | 11 |
| β-strand | 40-43 | 4 | 10 |
| β-strand | 50-56 | 7 | 10 |
| β-strand | 59-61 | 3 | 11 |
| β-strand | 66 | 1 | 12 |
| β-strand | 70 | 1 | 12 |
| β-strand | 75-76 | 2 | 12 |
| β-strand | 79-89 | 11 | 12 |
| β-strand | 97-98 | 2 | 10 |
| β-strand | 102 | 1 | 10 |
| β-strand | 111-120 | 10 | 6 |
| β-strand | 139-149 | 11 | 6 |
| β-strand | 153-158 | 6 | 12 |
| α-helix | 159-160 | 2 | |
| β-strand | 165-171 | 7 | 12 |
| β-strand | 174-175 | 2 | 13 |
| β-strand | 181-182 | 2 | 13 |
| β-strand | 192 | 1 | 12 |
| β-strand | 197 | 1 | 14 |
| α-helix | 206-208 | 3 | |
| β-strand | 210 | 1 | 14 |
| α-helix | 218-221 | 4 | |
| β-strand | 224 | 1 | 11 |
| β-strand | 229-235 | 7 | 10 |
| β-strand | 242-260 | 19 | 12 |
| β-strand | 265-285 | 21 | 12 |
| β-strand | 290-292 | 3 | 12 |
Chain B: 5 helices, 27 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-5 | 4 | |
| β-strand | 7 | 1 | 9 |
| α-helix | 8 | 1 | |
| β-strand | 14 | 1 | 15 |
| β-strand | 21-22 | 2 | 16 |
| β-strand | 26-29 | 4 | 17 |
| β-strand | 34-37 | 4 | 17 |
| β-strand | 40-42 | 3 | 16 |
| β-strand | 50-56 | 7 | 16 |
| β-strand | 59-61 | 3 | 17 |
| β-strand | 66 | 1 | 18 |
| β-strand | 70 | 1 | 18 |
| β-strand | 75-89 | 15 | 18 |
| β-strand | 97-98 | 2 | 16 |
| β-strand | 102 | 1 | 16 |
| β-strand | 111-120 | 10 | 6 |
| β-strand | 139-149 | 11 | 6 |
| β-strand | 153-158 | 6 | 18 |
| α-helix | 159-160 | 2 | |
| β-strand | 164-171 | 8 | 18 |
| β-strand | 174-175 | 2 | 19 |
| β-strand | 181-182 | 2 | 19 |
| β-strand | 192 | 1 | 18 |
| β-strand | 197 | 1 | 20 |
| α-helix | 206-208 | 3 | |
| β-strand | 210 | 1 | 20 |
| α-helix | 218-221 | 4 | |
| β-strand | 224 | 1 | 17 |
| β-strand | 229-235 | 7 | 16 |
| β-strand | 242-260 | 19 | 18 |
| β-strand | 265-285 | 21 | 18 |
| β-strand | 290-292 | 3 | 18 |
Chain C: 5 helices, 27 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-5 | 4 | |
| β-strand | 7 | 1 | 15 |
| α-helix | 8 | 1 | |
| β-strand | 14 | 1 | 21 |
| β-strand | 21-22 | 2 | 22 |
| β-strand | 26-29 | 4 | 23 |
| β-strand | 34-37 | 4 | 23 |
| β-strand | 40-42 | 3 | 22 |
| β-strand | 50-56 | 7 | 22 |
| β-strand | 59-61 | 3 | 23 |
| β-strand | 66 | 1 | 24 |
| β-strand | 70 | 1 | 24 |
| β-strand | 75-89 | 15 | 24 |
| β-strand | 97-98 | 2 | 22 |
| β-strand | 102 | 1 | 22 |
| β-strand | 111-120 | 10 | 6 |
| β-strand | 139-149 | 11 | 6 |
| β-strand | 153-158 | 6 | 24 |
| α-helix | 159-160 | 2 | |
| β-strand | 165-171 | 7 | 24 |
| β-strand | 174-175 | 2 | 25 |
| β-strand | 181-182 | 2 | 25 |
| β-strand | 192 | 1 | 24 |
| β-strand | 197 | 1 | 26 |
| α-helix | 206-208 | 3 | |
| β-strand | 210 | 1 | 26 |
| α-helix | 218-221 | 4 | |
| β-strand | 224 | 1 | 23 |
| β-strand | 229-235 | 7 | 22 |
| β-strand | 242-260 | 19 | 24 |
| β-strand | 265-285 | 21 | 24 |
| β-strand | 290-292 | 3 | 24 |
Chains D, E and F: 5 helices, 28 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-5 | 4 | |
| β-strand | 7 | 1 | 21 |
| α-helix | 8 | 1 | |
| β-strand | 14 | 1 | 27 |
| β-strand | 21-22 | 2 | 28 |
| β-strand | 26-29 | 4 | 29 |
| β-strand | 34-37 | 4 | 29 |
| β-strand | 40-42 | 3 | 28 |
| β-strand | 50-56 | 7 | 28 |
| β-strand | 59-61 | 3 | 29 |
| β-strand | 66 | 1 | 30 |
| β-strand | 70 | 1 | 30 |
| β-strand | 75-76 | 2 | 30 |
| β-strand | 79-89 | 11 | 30 |
| β-strand | 97-98 | 2 | 28 |
| β-strand | 102 | 1 | 28 |
| β-strand | 111-120 | 10 | 6 |
| β-strand | 139-149 | 11 | 6 |
| β-strand | 153-158 | 6 | 30 |
| α-helix | 159-160 | 2 | |
| β-strand | 164-171 | 8 | 30 |
| β-strand | 174-175 | 2 | 31 |
| β-strand | 181-182 | 2 | 31 |
| β-strand | 192 | 1 | 30 |
| β-strand | 197 | 1 | 32 |
| α-helix | 206-208 | 3 | |
| β-strand | 210 | 1 | 32 |
| α-helix | 218-221 | 4 | |
| β-strand | 224 | 1 | 29 |
| β-strand | 229-235 | 7 | 28 |
| β-strand | 242-260 | 19 | 30 |
| β-strand | 265-285 | 21 | 30 |
| β-strand | 290-292 | 3 | 30 |
Chain G: 5 helices, 28 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-5 | 4 | |
| β-strand | 7 | 1 | 1 |
| α-helix | 8 | 1 | |
| β-strand | 14 | 1 | 2 |
| β-strand | 21-22 | 2 | 3 |
| β-strand | 26-29 | 4 | 4 |
| β-strand | 34-37 | 4 | 4 |
| β-strand | 40-42 | 3 | 3 |
| β-strand | 50-56 | 7 | 3 |
| β-strand | 59-61 | 3 | 4 |
| β-strand | 66 | 1 | 5 |
| β-strand | 70 | 1 | 5 |
| β-strand | 75-76 | 2 | 5 |
| β-strand | 79-89 | 11 | 5 |
| β-strand | 97-98 | 2 | 3 |
| β-strand | 102 | 1 | 3 |
| β-strand | 111-120 | 10 | 6 |
| β-strand | 139-149 | 11 | 6 |
| β-strand | 153-158 | 6 | 5 |
| α-helix | 159-160 | 2 | |
| β-strand | 165-171 | 7 | 5 |
| β-strand | 174-175 | 2 | 7 |
| β-strand | 181-182 | 2 | 7 |
| β-strand | 192 | 1 | 5 |
| β-strand | 197 | 1 | 8 |
| α-helix | 206-208 | 3 | |
| β-strand | 210 | 1 | 8 |
| α-helix | 218-221 | 4 | |
| β-strand | 224 | 1 | 4 |
| β-strand | 229-235 | 7 | 3 |
| β-strand | 242-260 | 19 | 5 |
| β-strand | 265-285 | 21 | 5 |
| β-strand | 290-292 | 3 | 5 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Alpha-hemolysin | A, B, C, D, E, F, G | protein | 293 | Staphylococcus aureus | Q2G1X0 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G), FASTA
>9KTO_1 Alpha-hemolysin (chains A, B, C, D, E, F, G)
ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGT
IAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGF
NGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWG
PYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASK
QQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| P1O | 1,2-didecanoyl-sn-glycero-3-phosphocholine | C28 H57 N O8 P | 7 |
Primary citation
Structural insights into pre-pore intermediates of alpha-hemolysin in the lipidic environment. Chatterjee, A., Roy, A., Satheesh, T. et al. Nat Commun (2025) 16:6348-6348. DOI 10.1038/s41467-025-61741-x · PubMed
Other PDB entries of the same protein (UniProt Q2G1X0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9SHR 2.08 Å, Alpha-Hemolysin of S.aureus (monomer) in complex with the small molecule…
- 4U6V 2.56 Å, Mechanisms of Neutralization of a Human Anti-Alpha Toxin Antibody
- 9KG0 2.6 Å, Alpha-hemolysin heptameric late pre-pore state derived from 10:0 PC/Sphingomyelin…
- 9KG6 2.8 Å, Alpha-hemolysin heptameric pore state derived from 10:0 PC liposomes
- 9KRF 2.8 Å, Alpha-hemolysin heptameric pore state bound to 10:0 PC lipid chains derived from 10:0 PC…
- 9KG1 2.9 Å, Alpha-hemolysin heptameric pre-pore state derived from 10:0 PC liposomes.
- 9KTM 2.9 Å, Alpha-hemolysin heptameric pre-pore state bound to 10:PC lipid chains derived from 10:0…
- 9KRE 3.0 Å, Alpha-hemolysin heptameric POPC bound pore state derived from egg PC/Cholesterol (3:1…
- 9KG3 3.07 Å, Alpha-hemolysin heptameric pore state derived from egg PC/Cholesterol (3:1 molar ratio)…
- 7O1Q 3.4 Å, Amyloid beta oligomer displayed on the alpha hemolysin scaffold
Browse structure collections
About this viewer
MolViewer shows 9KTO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.