9L1L: Anti-HEL AiTab

Structure of anti-HEL AiTab. Determined by electron microscopy at 3.09 Å resolution. Released 18 Feb 2026.

Method: Electron microscopy
Resolution: 3.09 Å
Organisms: Mus musculus, Gallus gallus
Chains: 5
Atoms: 6,155
Mol. weight: 91.42 kDa
Released: 18 Feb 2026

Explore 9L1L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9L1L contains 24 α-helices and 66 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	1
β-strand	14-18	5	1
α-helix	20-22	3
β-strand	23-30	8	1
β-strand	33-39	7	1
β-strand	44-47	4	1
α-helix	50-52	3
β-strand	57	1	2
α-helix	60-80	21
α-helix	84-86	3
β-strand	92-97	6	3
β-strand	107-116	10	3
β-strand	122-127	6	4
β-strand	130-131	2	4
β-strand	136-143	8	3
β-strand	149-157	9	3
β-strand	165-170	6	4
β-strand	178-180	3	4

Chain B: 8 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	8-18	11	1
β-strand	23-31	9	1
β-strand	36-41	6	1
β-strand	46-48	3	1
α-helix	52-54	3
α-helix	55-64	10
α-helix	66-72	7
α-helix	73-78	6
α-helix	79-80	2
α-helix	81-85	5
β-strand	97-102	6	5
β-strand	114-121	8	5
β-strand	127-130	4	6
α-helix	132-134	3
β-strand	154-160	7	5
β-strand	170-175	6	6
α-helix	182	1
β-strand	183-187	5	6

Chain C: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	11-12	2	8
β-strand	18-25	8	7
β-strand	33-40	8	9
β-strand	46-53	8	9
β-strand	58-60	3	9
β-strand	68-73	6	7
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-100	9	9
β-strand	110-111	2	9
β-strand	115-117	3	9
β-strand	118-119	2	8
α-helix	123-124	2
α-helix	126-127	2
β-strand	128-132	5	10
β-strand	143-153	11	10
β-strand	159-160	2	11
β-strand	170-173	4	10
α-helix	174-176	3
β-strand	177-179	3	10
β-strand	182-192	11	10
α-helix	193-195	3
β-strand	202-206	5	11
β-strand	214-217	4	11

Chain D: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	12
β-strand	10-13	4	13
β-strand	17-25	9	12
β-strand	34-38	5	13
β-strand	45-49	5	13
β-strand	52-54	3	13
α-helix	55	1
β-strand	62-65	4	12
β-strand	70-78	9	12
α-helix	80-82	3
β-strand	85-90	6	13
β-strand	96-97	2	13
β-strand	102-105	4	13
β-strand	110	1	14
β-strand	113-117	5	15
α-helix	118-120	3
α-helix	121-125	5
β-strand	128-138	11	15
β-strand	139	1	14
β-strand	143-149	7	16
β-strand	152-153	2	16
β-strand	158-162	5	15
α-helix	163-164	2
β-strand	172-181	10	15
α-helix	182-187	6
β-strand	190-197	8	16
β-strand	200-209	10	16

Chain P: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	51	1	2
α-helix	55-57	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H-2 class II histocompatibility antigen, A-K alpha chain	A	protein	179	Mus musculus	P01910 (AlphaFold model)
H-2 class II histocompatibility antigen, A-K beta chain	B	protein	185	Mus musculus	P06343 (AlphaFold model)
11-72 heavy chain(V region)-mouse IgG2b CH1	C	protein	218	Mus musculus
11-72 kappa chain(V region)-kappa chain	D	protein	211	Mus musculus
Lysozyme C	P	protein	15	Gallus gallus	P00698 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9L1L_1 H-2 class II histocompatibility antigen, A-K alpha chain (chains A)
DIEADHVGSYGITVYQSPGDIGQYTFEFDGDELFYVDLDKKETVWMLPEFAQLRRFEPQG
GLQNIATGKHNLEILTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVIN
ITWLRNSKSVTDGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKH

Sequence of entity 2 (B), FASTA

>9L1L_2 H-2 class II histocompatibility antigen, A-K beta chain (chains B)
ERHFVHQFQPFCYFTNGTQRIRLVIRYIYNREEYVRFDSDVGEYRAVTELGRPDAEYWNK
QYLERTRAELDTVCRHNYEKTETPTSLRRLEQPSVVISLSRTEALNHHNTLVCSVTDFYP
AKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPI
TVEWR

Sequence of entity 3 (C), FASTA

>9L1L_3 11-72 heavy chain(V region)-mouse IgG2b CH1 (chains C)
DVQLQESGPGLVKPSQSLSLTCSVTGYSITSAYYWNWIRQFPGNKLEWMGYIRYDGSNNY
NPSLKNRISITRDTSKNQFFLKLNSVTTEDTATYYCARAYGSSYDYAMDYWGQGTSVTVS
SAKTTPPSVYPLAPGCGDTTGSSVTSGCLVKGYFPEPVTVTWNSGSLSSSVHTFPALLQS
GLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKL

Sequence of entity 4 (D), FASTA

>9L1L_4 11-72 kappa chain(V region)-kappa chain (chains D)
DIVMTQSHKFMSTSVGDRVSITCKASQDVGTTVAWYQQKPGQSPKLLIYWASTRHTGVPD
RFTGSGSGTDFTLTISNVQSEDLADYFCQQYSRYPTFGGGTKLEIKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRN

Sequence of entity 5 (P), FASTA

>9L1L_5 Lysozyme C (chains P)
STDYGILQINSRWWA

Primary citation

Antigen-specific immune regulation mediated by self TCR-like antibodies. Kishida, K., Kawakami, K., Yonekura, K. et al. To be published.

Other PDB entries of the same protein (UniProt P01910 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IAK 1.9 Å, Histocompatibility antigen I-ak
1D9K 3.2 Å, Crystal structure of complex between D10 TCR and pmhc I-ak/ca
1JL4 4.3 Å, Crystal structure of the human CD4 N-terminal two domain fragment complexed to a class…

Browse structure collections

About this viewer

MolViewer shows 9L1L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.