9L1Q: ICT01-BTN2A1/BTN3A1/BTN3A2 complex
Cryo-EM structure of the ICT01-BTN2A1/BTN3A1/BTN3A2 complex (2 fabs). Determined by electron microscopy at 4.0 Å resolution. Released 17 Dec 2025.
- Method
- Electron microscopy
- Resolution
- 4.0 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 13,358
- Mol. weight
- 326.16 kDa
- Released
- 17 Dec 2025
Explore 9L1Q in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9L1Q contains 33 α-helices and 179 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 2 helices, 26 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 31 | 1 | 1 |
| β-strand | 41 | 1 | 2 |
| β-strand | 47-48 | 2 | 3 |
| β-strand | 51-52 | 2 | 4 |
| β-strand | 54 | 1 | 1 |
| α-helix | 56 | 1 | |
| β-strand | 63-67 | 5 | 5 |
| β-strand | 74-78 | 5 | 5 |
| β-strand | 79 | 1 | 6 |
| β-strand | 82 | 1 | 6 |
| β-strand | 88 | 1 | 5 |
| β-strand | 107-108 | 2 | 4 |
| β-strand | 111-112 | 2 | 3 |
| β-strand | 121 | 1 | 7 |
| β-strand | 126-128 | 3 | 5 |
| β-strand | 134 | 1 | 5 |
| β-strand | 140 | 1 | 7 |
| β-strand | 142 | 1 | 2 |
| α-helix | 148-149 | 2 | |
| β-strand | 150 | 1 | 8 |
| β-strand | 156-157 | 2 | 9 |
| β-strand | 160-161 | 2 | 9 |
| β-strand | 165-170 | 6 | 8 |
| β-strand | 175-179 | 5 | 10 |
| β-strand | 190-195 | 6 | 8 |
| β-strand | 201-206 | 6 | 8 |
| β-strand | 216-223 | 8 | 10 |
| β-strand | 228-235 | 8 | 10 |
Chain B: 3 helices, 26 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 32-33 | 2 | 11 |
| β-strand | 39-41 | 3 | 12 |
| β-strand | 47-53 | 7 | 11 |
| β-strand | 63-66 | 4 | 13 |
| β-strand | 76-79 | 4 | 13 |
| β-strand | 82-83 | 2 | 13 |
| α-helix | 85-87 | 3 | |
| β-strand | 96-99 | 4 | 11 |
| β-strand | 107-112 | 6 | 11 |
| β-strand | 121 | 1 | 12 |
| β-strand | 124-129 | 6 | 13 |
| β-strand | 132-137 | 6 | 13 |
| β-strand | 140-142 | 3 | 12 |
| β-strand | 144 | 1 | 14 |
| β-strand | 150-151 | 2 | 15 |
| β-strand | 157 | 1 | 16 |
| β-strand | 160 | 1 | 16 |
| β-strand | 162 | 1 | 17 |
| β-strand | 165-170 | 6 | 15 |
| β-strand | 171 | 1 | 14 |
| β-strand | 175-179 | 5 | 18 |
| β-strand | 186 | 1 | 18 |
| β-strand | 191-195 | 5 | 15 |
| α-helix | 197-199 | 3 | |
| α-helix | 200 | 1 | |
| β-strand | 201-205 | 5 | 15 |
| β-strand | 208 | 1 | 17 |
| β-strand | 216-223 | 8 | 18 |
| β-strand | 228-235 | 8 | 18 |
Chain E: 5 helices, 20 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 33-34 | 2 | 19 |
| α-helix | 35-36 | 2 | |
| α-helix | 39 | 1 | |
| β-strand | 40-43 | 4 | 20 |
| β-strand | 48-54 | 7 | 19 |
| β-strand | 64-69 | 6 | 20 |
| β-strand | 75-79 | 5 | 20 |
| β-strand | 80 | 1 | 21 |
| β-strand | 83 | 1 | 21 |
| β-strand | 97-100 | 4 | 19 |
| β-strand | 108-113 | 6 | 19 |
| α-helix | 118-120 | 3 | |
| β-strand | 122-129 | 8 | 20 |
| β-strand | 134-144 | 11 | 20 |
| α-helix | 148-150 | 3 | |
| β-strand | 151-154 | 4 | 22 |
| β-strand | 164-171 | 8 | 22 |
| β-strand | 176-180 | 5 | 23 |
| β-strand | 186 | 1 | 23 |
| β-strand | 190-191 | 2 | 22 |
| β-strand | 195-196 | 2 | 22 |
| β-strand | 202-208 | 7 | 22 |
| β-strand | 219-223 | 5 | 23 |
| β-strand | 230-236 | 7 | 23 |
| α-helix | 239-241 | 3 | |
Chain F: 4 helices, 24 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 34 | 1 | 24 |
| β-strand | 40-41 | 2 | 25 |
| β-strand | 51 | 1 | 26 |
| β-strand | 53 | 1 | 24 |
| β-strand | 65 | 1 | 27 |
| β-strand | 66-68 | 3 | 28 |
| β-strand | 79 | 1 | 27 |
| β-strand | 80 | 1 | 29 |
| β-strand | 83 | 1 | 29 |
| α-helix | 91-93 | 3 | |
| β-strand | 100-103 | 4 | 26 |
| β-strand | 108-110 | 3 | 26 |
| α-helix | 118-120 | 3 | |
| β-strand | 123-128 | 6 | 28 |
| β-strand | 135-140 | 6 | 28 |
| β-strand | 141-142 | 2 | 25 |
| β-strand | 151-154 | 4 | 23 |
| β-strand | 158 | 1 | 30 |
| β-strand | 161 | 1 | 30 |
| β-strand | 162-171 | 10 | 23 |
| α-helix | 174-176 | 3 | |
| β-strand | 178-181 | 4 | 22 |
| β-strand | 191 | 1 | 23 |
| β-strand | 195-196 | 2 | 23 |
| β-strand | 202-210 | 9 | 23 |
| β-strand | 218-224 | 7 | 22 |
| β-strand | 228-237 | 10 | 22 |
| α-helix | 239-241 | 3 | |
Chain h: 8 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3 | 1 | 42 |
| α-helix | 5 | 1 | |
| β-strand | 6 | 1 | 43 |
| α-helix | 7-9 | 3 | |
| β-strand | 10 | 1 | 44 |
| β-strand | 18-23 | 6 | 43 |
| β-strand | 25 | 1 | 42 |
| β-strand | 34-39 | 6 | 44 |
| β-strand | 49-51 | 3 | 44 |
| β-strand | 58 | 1 | 44 |
| α-helix | 62-64 | 3 | |
| β-strand | 68-73 | 6 | 43 |
| β-strand | 78-83 | 6 | 43 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-98 | 7 | 44 |
| β-strand | 111-112 | 2 | 44 |
| β-strand | 116-118 | 3 | 44 |
| β-strand | 129-132 | 4 | 45 |
| α-helix | 133-134 | 2 | |
| α-helix | 137-140 | 4 | |
| β-strand | 144-154 | 11 | 45 |
| β-strand | 160-163 | 4 | 46 |
| β-strand | 168 | 1 | 46 |
| β-strand | 173-174 | 2 | 45 |
| α-helix | 175-177 | 3 | |
| β-strand | 185-194 | 10 | 45 |
| β-strand | 204-209 | 6 | 46 |
| β-strand | 214-219 | 6 | 46 |
| α-helix | 220-221 | 2 | |
Chain H: 3 helices, 23 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-6 | 4 | 31 |
| β-strand | 10-12 | 3 | 32 |
| β-strand | 18-25 | 8 | 31 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 6 | 32 |
| β-strand | 45-51 | 7 | 32 |
| β-strand | 58-60 | 3 | 32 |
| β-strand | 68-73 | 6 | 31 |
| β-strand | 78-83 | 6 | 31 |
| β-strand | 92-99 | 8 | 32 |
| β-strand | 109-112 | 4 | 32 |
| β-strand | 116-120 | 5 | 32 |
| β-strand | 126 | 1 | 33 |
| β-strand | 129-132 | 4 | 34 |
| α-helix | 134-136 | 3 | |
| α-helix | 138-141 | 4 | |
| β-strand | 144-154 | 11 | 34 |
| β-strand | 155 | 1 | 33 |
| β-strand | 159-163 | 5 | 35 |
| β-strand | 168 | 1 | 35 |
| β-strand | 173-174 | 2 | 34 |
| β-strand | 178-180 | 3 | 34 |
| β-strand | 184-194 | 11 | 34 |
| β-strand | 204 | 1 | 36 |
| β-strand | 205-209 | 5 | 35 |
| β-strand | 219 | 1 | 36 |
Chain l: 4 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-7 | 4 | 47 |
| β-strand | 10-11 | 2 | 48 |
| β-strand | 19-29 | 11 | 47 |
| β-strand | 33-38 | 6 | 48 |
| β-strand | 44-49 | 6 | 48 |
| β-strand | 53-54 | 2 | 48 |
| α-helix | 55 | 1 | |
| β-strand | 62-66 | 5 | 47 |
| β-strand | 68-75 | 8 | 47 |
| β-strand | 85-90 | 6 | 48 |
| β-strand | 102-104 | 3 | 48 |
| α-helix | 110-111 | 2 | |
| β-strand | 116-118 | 3 | 49 |
| β-strand | 129-137 | 9 | 49 |
| β-strand | 145-150 | 6 | 50 |
| β-strand | 154 | 1 | 50 |
| β-strand | 159-164 | 6 | 49 |
| β-strand | 174-182 | 9 | 49 |
| α-helix | 183-187 | 5 | |
| β-strand | 191-197 | 7 | 50 |
| α-helix | 204 | 1 | |
| β-strand | 205-210 | 6 | 50 |
Chain L: 4 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-7 | 4 | 37 |
| β-strand | 10-12 | 3 | 38 |
| β-strand | 19-21 | 3 | 39 |
| β-strand | 22-29 | 8 | 37 |
| β-strand | 33-38 | 6 | 38 |
| β-strand | 45-49 | 5 | 38 |
| β-strand | 53-54 | 2 | 38 |
| α-helix | 55 | 1 | |
| β-strand | 62-65 | 4 | 39 |
| β-strand | 68-70 | 3 | 37 |
| β-strand | 72-75 | 4 | 39 |
| β-strand | 85-90 | 6 | 38 |
| α-helix | 96 | 1 | |
| β-strand | 98 | 1 | 38 |
| β-strand | 102-105 | 4 | 38 |
| β-strand | 118 | 1 | 40 |
| α-helix | 123-126 | 4 | |
| β-strand | 129-139 | 11 | 40 |
| β-strand | 144-150 | 7 | 41 |
| β-strand | 153 | 1 | 41 |
| β-strand | 162-164 | 3 | 40 |
| β-strand | 173-182 | 10 | 40 |
| β-strand | 191-198 | 8 | 41 |
| α-helix | 204 | 1 | |
| β-strand | 205-210 | 6 | 41 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Butyrophilin subfamily 2 member A1 | A, B | protein | 534 | Homo sapiens | Q7KYR7 (AlphaFold model) |
| Butyrophilin subfamily 3 member A2 | E | protein | 340 | Homo sapiens | P78410 (AlphaFold model) |
| Butyrophilin subfamily 3 member A1 | F | protein | 539 | Homo sapiens | O00481 (AlphaFold model) |
| ICT01 heavy chain | H, h | protein | 255 | Homo sapiens | |
| ICT01 light chain | L, l | protein | 236 | Homo sapiens | |
Sequence of entity 1 (A, B), FASTA
>9L1Q_1 Butyrophilin subfamily 2 member A1 (chains A, B)
MDMRVPAQLLGLLLLWLSGARCQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRW
FRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCY
FQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVA
PALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSP
CAVALPIIVVILMIPIAVCIYWINKLQKEKKILSGEKEFERETREIALKELEKERVQKEE
ELQVKEKLQEELRWRRTFLHAVDVVLDPDTAHPDLFLSEDRRSVRRCPFRHLGESVPDNP
ERFDSQPCVLGRESFASGKHYWEVEVENVIEWTVGVCRDSVERKGEVLLIPQNGFWTLEM
HKGQYRAVSSPDRILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFSVPVRP
FFRLGCEDSPIFICPALTGANGVTVPEEGLTLHRVGTHQSLGSSGMDYKDDDDK
Sequence of entity 2 (E), FASTA
>9L1Q_2 Butyrophilin subfamily 3 member A2 (chains E)
MDMRVPAQLLGLLLLWLSGARCQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKW
VSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCY
FQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENI
PAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQP
WIAALAGTLPILLLLLAGASYFLWRQQKEITALSSEIESEQEMKEMGYAATEREISLRES
LQEELKRKKIQYLTRGEESSSDTNKSAGSSGMDYKDDDDK
Sequence of entity 3 (F), FASTA
>9L1Q_3 Butyrophilin subfamily 3 member A1 (chains F)
MDMRVPAQLLGLLLLWLSGARCQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKW
VSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCY
FQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENI
PTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQR
WIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQFRKKKREQELREMAWSTMKQEQSTRVK
LLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILLVSEDQRSVQRAKE
PQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKGWVKMTPE
NGFWTMGLTDGNKYRTLTEPRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLD
VSFSEALYPVFRILTLEPTALTICPAGSSGAWSHPQFEKGGGSGGGSGGSAWSHPQFEK
Sequence of entity 4 (H, h), FASTA
>9L1Q_4 ICT01 heavy chain (chains H, h)
MEFGLSWLFLVAILKGVQCQVQLVQSGAEVKKPGASVKLSCKASGYIFTRYYMYWVKQRP
GQGLEWIGEINPNNGGTKFNEKFKNRATLTVDKSISTAYMELSRLRSDDTAVYYCSREDD
YDGTPFAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
PKSCGGSHHHHHHHH
Sequence of entity 5 (L, l), FASTA
>9L1Q_5 ICT01 light chain (chains L, l)
MDMRVPAQLLGLLLLWLSGARCDIQMTQSPSSLSASVGDRVTITCHASQNINVWLSWYQQ
KPGKAPKLLIYKASNLHTGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQGQTYPYTF
GQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGN
SQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Primary citation
Cryo-EM structure of the ICT01-BTN2A1/BTN3A1/BTN3A2 complex at 4 Angtroms resolution (2 fabs). Xin, W.Z., Huang, B.D., Zhou, Q. To be published.
Other PDB entries of the same protein (UniProt Q7KYR7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8IGT 1.56 Å, Crystal Structure of Intracellular B30.2 Domain of BTN2A1
- 8DFW 2.1 Å, Crystal Structure of Human BTN2A1 in Complex With Vgamma9-Vdelta2 T Cell Receptor
- 8JYE 2.18 Å, Crystal Structure of Intracellular B30.2 Domain of BTN3A1 and BTN2A1 in Complex with HMBPP
- 8JYC 2.29 Å, Crystal Structure of Intracellular B30.2 Domain of BTN3A1 and BTN2A1 in Complex with DMAPP
- 8VC7 2.76 Å, Crystal Structure of Human BTN2A1 ectodomain in complex with Antagonist 2A1.9 Fab
- 8ZHR 3.0 Å, Cryo-EM structure of the full-length pAg-bound BTN2A1-BTN3A1-BTN3A2 complex
- 9JQR 3.0 Å, Cryo-EM structure of the Vgamma9Vdelta2 TCR-engaged BTN3A1-BTN3A2-BTN2A1 complex
- 9IRD 3.2 Å, Cryo-EM structure of BTN2A1-BTN3A1-BTN3A2 mutant (BTN3A1 H381R, BTN2A1 R477A/T510A) in…
- 9JQQ 3.26 Å, Cryo-EM structure of the HMBPP-primed BTN3A1-BTN3A2-BTN2A1 complex
- 9II6 3.27 Å, Cryo-EM structure of the intracellular domains of BTN2A1-BTN3A1-BTN3A3
- 9JQ6 3.34 Å, Cryo-EM structure of BTN2A1 in complex with antagonist antibody TH002
- 9JQP 3.34 Å, Cryo-EM structure of the HMBPP-primed BTN3A1-BTN3A2-BTN2A1 in complex with agonist…
Browse structure collections
About this viewer
MolViewer shows 9L1Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.