9LLG: D1R

Cryo-EM structure of D1R in complex with de novo designed negative allosteric GEM targeting TM5/6/7. Determined by electron microscopy at 2.77 Å resolution. Released 4 Mar 2026.

Method: Electron microscopy
Resolution: 2.77 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 2
Atoms: 3,605
Mol. weight: 69.52 kDa
Ligands: PLM, A1EKL, CLR
Released: 4 Mar 2026

Explore 9LLG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LLG contains 24 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain M: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	13-42	30
α-helix	46-77	32

Chain R: 22 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	21-50	30
α-helix	52-55	4
α-helix	60-72	13
α-helix	73-77	5
α-helix	78-87	10
α-helix	97-126	30
α-helix	128-134	7
α-helix	137-160	24
β-strand	165	1	1
α-helix	189	1
β-strand	190	1	1
α-helix	191	1
α-helix	192-199	8
α-helix	200-204	5
α-helix	205-1243	39
α-helix	1248-1266	19
α-helix	1286-1305	20
α-helix	1309-1334	26
α-helix	1335-1339	5
α-helix	1340-294	26
α-helix	295-297	3
α-helix	310-321	12
α-helix	323-331	9
α-helix	335-345	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
D(1A) dopamine receptor,Soluble cytochrome b562	R	protein	516	Homo sapiens, Escherichia coli	P21728 (AlphaFold model)
De novo designed negative allosteric GPCR exoframe modulator targeting TM5/6/7	M	protein	95	Homo sapiens

Sequence of entity 1 (R), FASTA

>9LLG_1 D(1A) dopamine receptor,Soluble cytochrome b562 (chains R)
RTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNF
FVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVDR
YWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLAE
TIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRILKKELDALNDNWETLNDNLKV
IEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDAL
KLANEGKVKEAQAAAEQLKTTRDAILKPFIEELKELKGKPFLIDAVIMGVFVCCWLPFFI
LNCILPFCGSGETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRL
CPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIA
RPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT

Sequence of entity 2 (M), FASTA

>9LLG_2 De novo designed negative allosteric GPCR exoframe modulator targeting TM5/6/7 (chains M)
PSPVPPPPPPLPIWKILLIIGTILYIVVFLYISIFLYRLLKTFVPKEERKKWFKFLGILF
LIFLILLIYFVVYVIRVLFPPPPPPSPGPPPPPPP

Ligands and cofactors

ID	Name	Formula	Copies
PLM	Palmitic acid	C16 H32 O2	1
A1EKL	Flupentixol	C23 H25 F3 N2 O S	1
CLR	Cholesterol	C27 H46 O	2

Primary citation

GPCR exoframe modulator. Cheng, S., Guo, J., Zhou, Y. et al. To be published.

Other PDB entries of the same protein (UniProt P21728 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9WG6 2.44 Å, D1R-Gs in complexed with Dopamine/LY3154207/BMSA1/UNC9815
9WG0 2.59 Å, D1R-Gs in complexed with SKF81297/LY3154207/BMSA1/UNC10062
9LLJ 2.61 Å, Cryo-EM structure of D1R-Gs in complex with de novo designed GEM targetingTM1/2/4 and…
9LLF 2.64 Å, Cryo-EM structure of D1R-Gs in complex with de novo designed GEM targeting TM3/4/5
9WEU 2.65 Å, D1R-Gs in complexed with SKF81297/LY3154207/BMSA1
9I54 2.72 Å, Dopamine 1 receptor:GaS complex bound to 24
9LLH 2.73 Å, Cryo-EM structure of D1R-Gs in complex with de novo designed agonist-positive allosteric…
9I52 2.8 Å, Dopamine 1 receptor:GaS complex bound to 19B
7JVP 2.9 Å, Cryo-EM structure of SKF-83959-bound dopamine receptor 1 in complex with Gs protein
9LLE 2.9 Å, Cryo-EM structure of D1R-Gs in complex with de novo designed GEM targeting TM1/2/4
9LWC 2.9 Å, Cryo-EM structure of epinephrine bound dopamine receptor 1…
7JV5 3.0 Å, Cryo-EM structure of SKF-81297-bound dopamine receptor 1 in complex with Gs protein

Browse structure collections

About this viewer

MolViewer shows 9LLG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.