9LRC: Histamine H4 receptor-Gi protein complex

Cryo-EM structure of the histamine H4 receptor-Gi protein complex (Receptor focused). Determined by electron microscopy at 2.84 Å resolution. Released 11 Jun 2025.

Method: Electron microscopy
Resolution: 2.84 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,328
Mol. weight: 77.91 kDa
Ligands: HSM
Released: 11 Jun 2025

Explore 9LRC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LRC contains 15 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain R: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	12-43	32
α-helix	49-63	15
α-helix	64-68	5
α-helix	69-76	8
α-helix	84-117	34
α-helix	119-124	6
α-helix	129-154	26
α-helix	155-157	3
α-helix	167-170	4
α-helix	172-179	8
α-helix	180-184	5
α-helix	185-204	20
α-helix	290-328	39
α-helix	338-357	20
α-helix	363-373	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histamine H4 receptor,Genome polyprotein	R	protein	692	Homo sapiens	Q9H3N8 (AlphaFold model)

Sequence of entity 1 (R), FASTA

>9LRC_1 Histamine H4 receptor,Genome polyprotein (chains R)
MKTIIALSYIFCLVFADYKDDDDKGSGGSSGGGSPDTNSTINLSLSTRVTLAFFMSLVAF
AIMLGNALVILAFVVDKNLRHRSSYFFLNLAISDFFVGVISIPLYIPHTLFEWDFGKEIC
VFWLTTDYLLCTASVYNIVLISYDRYLSVSNAVSYRTQHTGVLKIVTLMVAVWVLAFLVN
GPMILVSESWKDEGSECEPGFFSEWYILAITSFLEFVIPVILVAYFNMNIYWSLWKRDHL
SRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKM
NSNTIASKMGSFSQSDSVALHQREHVELLRARRLAKSLAILLGVFAVCWAPYSLFTIVLS
FYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPLCHKRFQKAFLKIFCIKKQPLPSQHSRS
VSSGGSGGGSGGSSGGGSLEVLFQGPVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGE
GDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQ
ERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMA
DKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEK
RDHMVLLEFVTAAGITLGMDELYKHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
HSM	Histamine	C5 H9 N3	1

Primary citation

Structural insights into ligand recognition and G protein preferences across histamine receptors. Matsuzaki, Y., Sano, F.K., Oshima, H.S. et al. Commun Biol (2025) 8:957-957. DOI 10.1038/s42003-025-08363-7 · PubMed

Other PDB entries of the same protein (UniProt Q9H3N8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8YN9 2.3 Å, Cryo-EM structure of histamine H4 receptor in complex with histamine and Gi
9JED 2.58 Å, Cryo-EM structure of Histamine-bound Histamine receptor 4 H4R G protein complex
8YNA 2.63 Å, Cryo-EM structure of histamine H4 receptor in complex with immepip and Gi
9LRE 2.84 Å, Cryo-EM structure of the histamine H4 receptor-Gi protein complex (Overall)
9L42 2.9 Å, Cryo-EM structure of human histamine receptor H4R in complex with agonist histamine and…
7YFC 3.0 Å, Cryo-EM structure of the histamine-bound histamine H4 receptor and Gq complex
8HN8 3.0 Å, Cryo-EM structure of ligand histamine-bound Histamine H4 receptor Gi complex
8HOC 3.0 Å, Cryo-EM structure of ligand histamine-bound Histamine H4 receptor Gi complex
8JXW 3.01 Å, VUF6884-bound H4R/Gi complex
8JXX 3.06 Å, Clobenpropit-bound H4R/Gi complex
8JXT 3.07 Å, Histamine-bound H4R/Gi complex
7YFD 3.1 Å, Cryo-EM structure of the imetit-bound histamine H4 receptor and Gq complex

Browse structure collections

About this viewer

MolViewer shows 9LRC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.