Crystal structure of mRFP1 with a grafted calcium-binding sequence and one bound calcium ion in a calcium-containing solution. Determined by X-ray diffraction at 1.62 Å resolution. Released 4 Jun 2025.
Explore 9LSA in 3D Show helices and sheets RCSB PDB PDBe
9LSA contains 15 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-22 | 11 | 1 |
| β-strand | 25-36 | 12 | 1 |
| β-strand | 41-50 | 10 | 1 |
| α-helix | 52 | 1 | |
| α-helix | 54 | 1 | |
| α-helix | 58-60 | 3 | |
| α-helix | 62-64 | 3 | |
| α-helix | 70-72 | 3 | |
| β-strand | 74 | 1 | 1 |
| α-helix | 82-85 | 4 | |
| β-strand | 91-99 | 9 | 1 |
| β-strand | 104-114 | 11 | 1 |
| β-strand | 117-127 | 11 | 1 |
| β-strand | 140-143 | 4 | 1 |
| α-helix | 144-145 | 2 | |
| β-strand | 146-153 | 8 | 1 |
| β-strand | 162-173 | 12 | 1 |
| β-strand | 178-189 | 12 | 1 |
| α-helix | 194-196 | 3 | |
| β-strand | 199-210 | 12 | 1 |
| β-strand | 216-226 | 11 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-22 | 11 | 2 |
| β-strand | 25-36 | 12 | 2 |
| β-strand | 41-50 | 10 | 2 |
| α-helix | 52 | 1 | |
| α-helix | 54 | 1 | |
| α-helix | 58-60 | 3 | |
| α-helix | 62-64 | 3 | |
| β-strand | 74 | 1 | 2 |
| α-helix | 82-85 | 4 | |
| β-strand | 91-99 | 9 | 2 |
| β-strand | 104-114 | 11 | 2 |
| β-strand | 117-127 | 11 | 2 |
| β-strand | 140-143 | 4 | 2 |
| α-helix | 144-145 | 2 | |
| β-strand | 146-153 | 8 | 2 |
| β-strand | 162-173 | 12 | 2 |
| β-strand | 178-189 | 12 | 2 |
| α-helix | 194-196 | 3 | |
| β-strand | 199-210 | 12 | 2 |
| β-strand | 216-226 | 11 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Red fluorescent protein,grafted calcium-binding sequence | A, B | protein | 278 | Discosoma, synthetic construct | Q9U6Y8 (AlphaFold model) |
>9LSA_1 Red fluorescent protein,grafted calcium-binding sequence (chains A, B) MGGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELASSEDVIKEFMRFKVRMEGSVN GHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFXSKAYVKHPADIPDYLKL SFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEA STERMYPGDGDGDGEAELKGEIKMRLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKL DITSHNEDYTIVEQYERAEGRHSTGAGGSGGSENLYFQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
Water and common crystallization additives (PGE, PG4, EDO) are not listed.
Enhanced secretion through type 1 secretion system by grafting a calcium-binding sequence to modify the folding of cargo proteins. Uehara, R., Kamiya, Y., Maeda, S. et al. Protein Sci (2025) 34:e70165-e70165. DOI 10.1002/pro.70165 · PubMed
Other PDB entries of the same protein (UniProt Q9U6Y8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9LSA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.