9LSA: PDB entry 9LSA

Crystal structure of mRFP1 with a grafted calcium-binding sequence and one bound calcium ion in a calcium-containing solution. Determined by X-ray diffraction at 1.62 Å resolution. Released 4 Jun 2025.

Method: X-ray diffraction
Resolution: 1.62 Å
Organisms: Discosoma, synthetic construct
Chains: 2
Atoms: 3,890
Mol. weight: 63.55 kDa
Ligands: CA
Released: 4 Jun 2025

Explore 9LSA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LSA contains 15 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-22	11	1
β-strand	25-36	12	1
β-strand	41-50	10	1
α-helix	52	1
α-helix	54	1
α-helix	58-60	3
α-helix	62-64	3
α-helix	70-72	3
β-strand	74	1	1
α-helix	82-85	4
β-strand	91-99	9	1
β-strand	104-114	11	1
β-strand	117-127	11	1
β-strand	140-143	4	1
α-helix	144-145	2
β-strand	146-153	8	1
β-strand	162-173	12	1
β-strand	178-189	12	1
α-helix	194-196	3
β-strand	199-210	12	1
β-strand	216-226	11	1

Chain B: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-22	11	2
β-strand	25-36	12	2
β-strand	41-50	10	2
α-helix	52	1
α-helix	54	1
α-helix	58-60	3
α-helix	62-64	3
β-strand	74	1	2
α-helix	82-85	4
β-strand	91-99	9	2
β-strand	104-114	11	2
β-strand	117-127	11	2
β-strand	140-143	4	2
α-helix	144-145	2
β-strand	146-153	8	2
β-strand	162-173	12	2
β-strand	178-189	12	2
α-helix	194-196	3
β-strand	199-210	12	2
β-strand	216-226	11	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Red fluorescent protein,grafted calcium-binding sequence	A, B	protein	278	Discosoma, synthetic construct	Q9U6Y8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9LSA_1 Red fluorescent protein,grafted calcium-binding sequence (chains A, B)
MGGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELASSEDVIKEFMRFKVRMEGSVN
GHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFXSKAYVKHPADIPDYLKL
SFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEA
STERMYPGDGDGDGEAELKGEIKMRLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKL
DITSHNEDYTIVEQYERAEGRHSTGAGGSGGSENLYFQ

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Water and common crystallization additives (PGE, PG4, EDO) are not listed.

Primary citation

Enhanced secretion through type 1 secretion system by grafting a calcium-binding sequence to modify the folding of cargo proteins. Uehara, R., Kamiya, Y., Maeda, S. et al. Protein Sci (2025) 34:e70165-e70165. DOI 10.1002/pro.70165 · PubMed

Other PDB entries of the same protein (UniProt Q9U6Y8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2H5O 1.08 Å, Crystal structure of mOrange
8B7G 1.3 Å, Structure of oxygen-degraded rsCherry
7ZCT 1.33 Å, Structure of the red fluorescent protein mScarlet3 at pH 7.5
9LSC 1.38 Å, Crystal structure of mRFP1 with a grafted calcium-binding sequence and two bound calcium…
1ZGO 1.4 Å, High Resolution Crystal Structure of the Discosoma Red Fluorescent Protein (DsRed)
7OIN 1.4 Å, Crystal structure of LSSmScarlet - a genetically encoded red fluorescent protein with a…
8ARM 1.41 Å, Crystal structure of LSSmScarlet2
8ZXH 1.46 Å, Structure of the red fluorescent protein mScarlet3-H at pH 4.5
5LK4 1.47 Å, Structure of the Red Fluorescent Protein mScarlet at pH 7.8
8B65 1.55 Å, Structure of rsCherry crystallized in anaerobic conditions
2VAD 1.59 Å, Monomeric red fluorescent protein, DsRed.M1
2H5R 1.6 Å, Crystal structure of mStrawberry at pH 10.5

Browse structure collections

About this viewer

MolViewer shows 9LSA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.