9LSY: GdTCR-Fab complex

Structure of the gdTCR-Fab complex. Determined by electron microscopy at 3.23 Å resolution. Released 18 Feb 2026.

Method: Electron microscopy
Resolution: 3.23 Å
Organism: Homo sapiens
Chains: 8
Atoms: 10,160
Mol. weight: 145.95 kDa
Released: 18 Feb 2026

Explore 9LSY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LSY contains 18 α-helices and 132 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and D: 0 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	11
β-strand	13	1	12
β-strand	16-17	2	13
β-strand	22-29	8	11
β-strand	37-43	7	12
β-strand	47-53	7	12
β-strand	62-63	2	11
β-strand	66-71	6	11
β-strand	76-81	6	11
β-strand	91-98	8	12
β-strand	106-108	3	12
β-strand	113-114	2	12
β-strand	117-118	2	13
β-strand	125	1	14
β-strand	129-134	6	15
β-strand	137-145	9	15
β-strand	146	1	14
β-strand	151-155	5	16
β-strand	159-162	4	15
β-strand	166	1	15
β-strand	175-183	9	15
β-strand	190-195	6	16
β-strand	198-201	4	16

Chain B: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	13-17	5	17
β-strand	21-25	5	18
β-strand	35-41	7	17
β-strand	48-54	7	17
β-strand	59-62	4	17
α-helix	66-67	2
β-strand	71-74	4	18
β-strand	82-86	5	18
β-strand	94-102	9	17
β-strand	112-115	4	17
β-strand	120-124	5	17
β-strand	135-138	4	19
α-helix	143-148	6
β-strand	152-161	10	19
β-strand	167-168	2	20
β-strand	171	1	20
α-helix	178-180	3
β-strand	182-183	2	19
β-strand	187-188	2	19
β-strand	193-201	9	19
α-helix	203-205	3
β-strand	210-215	6	20
α-helix	220-222	3
β-strand	225-229	5	20
α-helix	230-232	3

Chain C: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	24-25	2	21
β-strand	30-33	4	22
β-strand	39-45	7	21
β-strand	53-58	6	22
β-strand	64-69	6	22
β-strand	73-74	2	22
α-helix	75	1
β-strand	82-87	6	21
β-strand	90-95	6	21
β-strand	104-110	7	22
α-helix	116	1
β-strand	118	1	22
β-strand	122-126	5	22

Chain E: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	22-26	5	23
β-strand	30-31	2	24
β-strand	37-44	8	23
β-strand	53-58	6	25
β-strand	65-70	6	25
β-strand	76-78	3	25
β-strand	86-91	6	23
β-strand	96-101	6	23
α-helix	106-108	3
β-strand	110-116	7	25
β-strand	117-118	2	26
β-strand	121-122	2	26
β-strand	129-131	3	25
β-strand	132-133	2	24

Chain F: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	25	1	27
β-strand	30-33	4	28
β-strand	39-44	6	27
β-strand	53-58	6	28
β-strand	64-69	6	28
β-strand	73-74	2	28
α-helix	75	1
β-strand	82-87	6	27
β-strand	90-95	6	27
β-strand	104-110	7	28
α-helix	116	1
β-strand	118	1	28
β-strand	122-126	5	28

Chain G: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	13-17	5	7
β-strand	21-25	5	8
β-strand	35-41	7	7
β-strand	48-54	7	7
β-strand	59-62	4	7
α-helix	66-67	2
β-strand	71-74	4	8
β-strand	82-86	5	8
β-strand	94-102	9	7
β-strand	112-115	4	7
β-strand	120-124	5	7
β-strand	135-138	4	9
α-helix	143-148	6
β-strand	152-161	10	9
β-strand	167-168	2	10
β-strand	171	1	10
α-helix	178-180	3
β-strand	182-183	2	9
β-strand	187-188	2	9
β-strand	193-201	9	9
α-helix	203-205	3
β-strand	210-215	6	10
α-helix	220-222	3
β-strand	225-229	5	10
α-helix	230	1

Chain H: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	26	1	29
β-strand	30-31	2	30
β-strand	37-42	6	29
β-strand	53-58	6	31
β-strand	65-70	6	31
β-strand	76-78	3	31
β-strand	86-91	6	29
β-strand	96-101	6	29
α-helix	106-108	3
β-strand	110-116	7	31
β-strand	117-118	2	32
β-strand	121-122	2	32
β-strand	129-131	3	31
β-strand	132-133	2	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TRA@ protein	A, D	protein	202	Homo sapiens	Q6PJ56 (AlphaFold model)
gamma chain	B, G	protein	224	Homo sapiens
Light chain	C, F	protein	107	Homo sapiens
Heavy chain	E, H	protein	117	Homo sapiens

Sequence of entity 1 (A, D), FASTA

>9LSY_1 TRA@ protein (chains A, D)
QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSG
RYSVNFKKAAKSVALTISALQLEDSAKYFCALGDPGGLNTDKLIFGKGTRVTVEPRSQPH
TKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYE
DSNSVTCSVQHDNKTVHSTDFE

Sequence of entity 2 (B, G), FASTA

>9LSY_2 gamma chain (chains B, G)
GTKSVTRPTRSSAEITCDLTVINAFYIHWYLHQEGKAPQRLLYYDVSNSKDVLESGLSPG
KYYTHTPRRWSWILILRNLIENDSGVYYCATWDRGNPKTHYYKKLFGSGTTLVVTDKQLD
ADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWQEKKSNTILGSQEGNTMKT
NDTYMKFSWLTVPEESLDKEHRCIVRHENNKNGVDQEIIFPPIK

Sequence of entity 3 (C, F), FASTA

>9LSY_3 Light chain (chains C, F)
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWHQQKPDGTVKLLIYYTSRLHSGVPS
RFSGSGSGTDYSLTISSLEQEDIATYFCQQSNTLPFTFGSGAKLEIK

Sequence of entity 4 (E, H), FASTA

>9LSY_4 Heavy chain (chains E, H)
SQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWLGVIWAGGNTDY
NSALMSRLSISKDNSKSRVFLKMNSLQTDDTAMYYCARETTASFAYWGRGTLVTVSA

Primary citation

Structure of the gdTCR-Fab complex. Bai, Y., Zhu, Y., Huang, Z. To be published.

Other PDB entries of the same protein (UniProt Q6PJ56 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LFH 2.3 Å, Crystal Structure of 9C2 TCR
6D7G 2.75 Å, Structure of 5F3 TCR in complex with HLA-A2/MART-1
4LHU 2.87 Å, Crystal Structure of 9C2 TCR bound to CD1d
8ZD4 2.9 Å, Cryo-EM structure of the gdTCR-ECD
4MNG 3.01 Å, Structure of the DP10.7 TCR with CD1d-sulfatide
4NDM 3.01 Å, Structure of the AB18.1 TCR
4MNH 3.3 Å, Structure of the DP10.7 TCR
8ZA6 3.43 Å, Cryo-EM structure of the gdTCR-CD3 complex

Browse structure collections

About this viewer

MolViewer shows 9LSY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.