9M01: SLA-1*0808 allele and ASFV antigenic peptide

Crystal structure of the SLA-1*0808 allele and ASFV antigenic peptide at 1.8 A resolution. Determined by X-ray diffraction at 1.56 Å resolution. Released 11 Feb 2026.

Method: X-ray diffraction
Resolution: 1.56 Å
Organisms: Sus scrofa, Asfivirus
Chains: 3
Atoms: 3,380
Mol. weight: 44.4 kDa
Released: 11 Feb 2026

Explore 9M01 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9M01 contains 16 α-helices and 30 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	5-15	11	1
α-helix	16-18	3
β-strand	20-29	10	1
β-strand	32-38	7	1
β-strand	47-48	2	1
α-helix	51-53	3
α-helix	58-85	28
β-strand	95-104	10	1
α-helix	105	1
β-strand	110-119	10	1
β-strand	122-127	6	1
β-strand	134-136	3	1
α-helix	139-150	12
α-helix	153-162	10
α-helix	164-175	12
α-helix	177-180	4
β-strand	184	1	2
α-helix	185-186	2
β-strand	187-194	8	3
β-strand	200-209	10	3
β-strand	210	1	2
β-strand	215-220	6	4
β-strand	224	1	4
α-helix	226-228	3
β-strand	230-231	2	3
α-helix	232-234	3
β-strand	235-236	2	3
β-strand	242-250	9	3
α-helix	255-257	3
β-strand	258-263	6	4
β-strand	271-273	3	4

Chain B: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	5
α-helix	6-7	2
β-strand	8-13	6	6
β-strand	23-32	10	6
β-strand	33	1	5
β-strand	38-43	6	7
β-strand	46-47	2	7
α-helix	48-49	2
β-strand	51-52	2	6
α-helix	53-55	3
β-strand	56-57	2	6
β-strand	63-71	9	6
β-strand	79-84	6	7
β-strand	92-95	4	7

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MHC class I antigen	A	protein	275	Sus scrofa	B1PJU3 (AlphaFold model)
Beta-2-microglobulin	B	protein	100	Sus scrofa	Q07717 (AlphaFold model)
Ser-ser-ile-ser-asp-ile-ser-pro-val	C	protein	9	Asfivirus

Sequence of entity 1 (A), FASTA

>9M01_1 MHC class I antigen (chains A)
GPHSLSYFYTAVSRPDRGDSRFFIVGYVDDTQFVRFDSDAPNAKMEPRAQWIQQEGPEYW
DRETQISKETAQTYRVSLNNLRGYYNQSEAGSHTYQNMYGCYLGPDGLLLRGYSQYGYDG
ADYIALNEDLRSWTAADMAAQISKRKWEAADAAEQWRSYLQGRCVEWLQKYLEMGKDTLQ
RAEPPKTHVTRHPSSDLGVTLRCWALGFYPKEISLTWQREGQDHSQDMELVETRPSGDGT
FQKWAALVVPPGEEQSYTCHVQHEGLQEPLTLRWD

Sequence of entity 2 (B), FASTA

>9M01_2 Beta-2-microglobulin (chains B)
EFVARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKD
WSFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH

Sequence of entity 3 (C), FASTA

>9M01_3 SER-SER-ILE-SER-ASP-ILE-SER-PRO-VAL (chains C)
SSISDISPV

Primary citation

Crystal structure of the SLA-1*0808 allele and ASFV antigenic peptide at 1.8 A resolution. Wang, S., Zhang, N. To be published.

Browse structure collections

About this viewer

MolViewer shows 9M01 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.