crystal structure of Arabidopsis thaliana ING2 PHD finger in complex with an H3K4me3 peptide. Determined by X-ray diffraction at 1.6 Å resolution. Released 5 Nov 2025.
Explore 9M4S in 3D Show helices and sheets RCSB PDB PDBe
9M4S contains 3 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 207-208 | 2 | 1 |
| β-strand | 213-214 | 2 | 1 |
| β-strand | 218-221 | 4 | 2 |
| β-strand | 232-234 | 3 | 2 |
| α-helix | 235-238 | 4 | |
| α-helix | 240-241 | 2 | |
| α-helix | 255-257 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-5 | 3 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PHD finger protein ING2 | A | protein | 74 | Arabidopsis thaliana | B3H615 (AlphaFold model) |
| Histone H3.1 | P | protein | 10 | Arabidopsis thaliana | P59226 (AlphaFold model) |
>9M4S_1 PHD finger protein ING2 (chains A) NRKDLMPIEEQPIDPNEPTYCVCHQVSFGDMIACDNENCQGGEWFHYTCVGLTPETRFKG KWYCPTCRLLPQSH
>9M4S_2 Histone H3.1 (chains P) ARTKQTARKS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
A pair of readers of histone H3K4 methylation recruit Polycomb repressive complex 2 to regulate photoperiodic flowering. Luo, X., Li, X., Chen, Z. et al. Nat Commun (2025) 16:9376-9376. DOI 10.1038/s41467-025-64419-6 · PubMed
MolViewer shows 9M4S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.