9ME8: PDB entry 9ME8

Co-crystal structure of maltose binding protein (MBP)-human SENP3 fusion protein in complex with PELP1 peptide. Determined by X-ray diffraction at 2.93 Å resolution. Released 6 Aug 2025.

Method: X-ray diffraction
Resolution: 2.93 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,157
Mol. weight: 74.51 kDa
Released: 6 Aug 2025

Explore 9ME8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9ME8 contains 41 α-helices and 35 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 40 helices, 33 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	7-10	4	1
α-helix	17-31	15
β-strand	35-38	4	1
α-helix	43-51	9
β-strand	59-63	5	1
α-helix	64-66	3
α-helix	67-72	6
β-strand	76	1	2
α-helix	77-79	3
α-helix	83-87	5
β-strand	89	1	3
α-helix	91-96	6
β-strand	98-99	2	4
β-strand	102-103	2	4
β-strand	105-111	7	1
β-strand	114-118	5	5
β-strand	128	1	6
α-helix	129-131	3
α-helix	132-142	11
β-strand	145-147	3	5
α-helix	154-163	10
β-strand	167-172	6	7
β-strand	175-182	8	7
α-helix	186-200	15
α-helix	210-218	9
β-strand	222-227	6	5
α-helix	229-231	3
α-helix	232-236	5
β-strand	242-245	4	5
α-helix	246-248	3
β-strand	249-250	2	6
β-strand	253-254	2	6
α-helix	257	1
β-strand	258-259	2	8
β-strand	260-266	7	1
β-strand	267	1	2
α-helix	273-279	7
α-helix	280-284	5
α-helix	287-296	10
β-strand	301-302	2	1
β-strand	304	1	3
α-helix	305-311	7
α-helix	315-326	12
β-strand	328-329	2	8
α-helix	330-331	2
α-helix	335-351	17
α-helix	357-368	12
α-helix	1312-1328	17
β-strand	1330	1	9
α-helix	1336-1347	12
α-helix	1354-1369	16
β-strand	1375	1	9
β-strand	1380-1383	4	10
β-strand	1386-1389	4	10
α-helix	1390-1393	4
α-helix	1394-1396	3
α-helix	1400-1402	3
α-helix	1404-1417	14
β-strand	1422-1424	3	11
α-helix	1428-1436	9
α-helix	1437-1440	4
α-helix	1450-1452	3
β-strand	1455-1462	8	11
β-strand	1465-1472	8	11
β-strand	1477-1481	5	11
β-strand	1486-1488	3	12
α-helix	1490-1505	16
α-helix	1509-1511	3
β-strand	1516-1519	4	11
α-helix	1532-1545	14
α-helix	1553-1555	3
α-helix	1556-1569	14

Chain B: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	765-767	3	12
α-helix	775	1
β-strand	776-778	3	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose/maltodextrin-binding periplasmic protein,Sentrin-specific protease 3	A	protein	635	Homo sapiens	Q9H4L4 (AlphaFold model)
Proline-, glutamic acid- and leucine-rich protein 1	B	protein	18	Homo sapiens	Q8IZL8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9ME8_1 Maltose/maltodextrin-binding periplasmic protein,Sentrin-specific protease 3 (chains A)
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDI
IFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNK
DLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIK
DVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSK
VNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL
GAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDA
ALAAAQTNAAAEEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGL
VLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVP
EKVHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTIT
YFDSQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDSGAFVLQY
CKHLALSQPFSFTQQDMPKLRRQIYKELCHCKLTV

Sequence of entity 2 (B), FASTA

>9ME8_2 Proline-, glutamic acid- and leucine-rich protein 1 (chains B)
AFVHYDKEEASDVEISLE

Primary citation

PELP1 coordinates the modular assembly and enzymatic activity of the rixosome complex. Gordon, J., Kaminski, A.M., Bommu, S.R. et al. Sci Adv (2025) 11:eadw4603-eadw4603. DOI 10.1126/sciadv.adw4603 · PubMed

Browse structure collections

About this viewer

MolViewer shows 9ME8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.