9MJA: PARP1 ART

PARP1 ART in complex with HPF1 and EB47. Determined by electron microscopy at 4.3 Å resolution. Released 21 Jan 2026.

Method: Electron microscopy
Resolution: 4.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,535
Mol. weight: 155.55 kDa
Ligands: UHB
Released: 21 Jan 2026

Explore 9MJA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9MJA contains 26 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	667-676	10
α-helix	789-796	8
β-strand	799-803	5	1
α-helix	804-805	2
α-helix	809-820	12
β-strand	829-841	13	1
α-helix	844-848	5
α-helix	849-851	3
β-strand	857-860	4	1
β-strand	861	1	2
α-helix	866-868	3
α-helix	869-875	7
α-helix	879-881	3
α-helix	886-888	3
β-strand	895-897	3	3
β-strand	898	1	2
α-helix	901-905	5
α-helix	906-908	3
β-strand	911	1	4
β-strand	914	1	4
β-strand	916-925	10	1
β-strand	929-932	4	3
β-strand	947-950	4	3
β-strand	954-955	2	5
β-strand	962-964	3	1
β-strand	967-969	3	1
β-strand	975-976	2	5
β-strand	986	1	5
β-strand	988-991	4	3
β-strand	998-1009	12	1

Chain B: 14 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	35-44	10
α-helix	51-63	13
α-helix	73-76	4
β-strand	79-80	2	6
α-helix	83-87	5
β-strand	115-120	6	6
β-strand	127-132	6	6
β-strand	142-147	6	6
β-strand	155-156	2	6
α-helix	161-175	15
α-helix	179-199	21
α-helix	208-215	8
α-helix	245-257	13
α-helix	261-267	7
α-helix	269-283	15
α-helix	287-300	14
α-helix	303-305	3
α-helix	306-319	14
α-helix	323-334	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Poly [ADP-ribose] polymerase 1	A	protein	1034	Homo sapiens	P09874 (AlphaFold model)
Histone PARylation factor 1	B	protein	347	Homo sapiens	Q9NWY4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9MJA_1 Poly [ADP-ribose] polymerase 1 (chains A)
MGSSHHHHHHSSGLVPRGSHMAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQ
SPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD
GIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHP
GCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVA
KKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAIL
DRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFR
EISYLKKLKVKKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGK
LSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQ
DVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSE
KRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKE
NRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYP
LEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGK
LSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQA
KVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKN
THATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIA
PPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISK
LPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLK
YLLKLKFNFKTSLW

Sequence of entity 2 (B), FASTA

>9MJA_2 Histone PARylation factor 1 (chains B)
SMVGGGGKRRPGGEGPQCEKTTDVKKSKFCEADVSSDLRKEVENHYKLSLPEDFYHFWKF
CEELDPEKPSDSLSASLGLQLVGPYDILAGKHKTKKKSTGLNFNLHWRFYYDPPEFQTII
IGDNKTQYHMGYFRDSPDEFPVYVGINEAKKNCIIVPNGDNVFAAVKLFLTKKLREITDK
KKINLLKNIDEKLTEAARELGYSLEQRTVKMKQRDKKVVTKTFHGAGLVVPVDKNDVGYR
ELPETDADLKRICKTIVEAASDEERLKAFAPIQEMMTFVQFANDECDYGMGLELGMDLFC
YGSHYFHKVAGQLLPLAYNLLKRNLFAEIIEEHLANRSQENIDQLAA

Ligands and cofactors

ID	Name	Formula	Copies
UHB	2-[4-[(2S,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]carbonyl…	C24 H27 N9 O6	1

Primary citation

PARP1-HPF1 structure and dynamics on nicked DNA suggest a mechanism for acute and localized ADP-ribosylation. Sverzhinsky, A., Xue, H., Langelier, M.F. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-69375-3 · PubMed

Other PDB entries of the same protein (UniProt P09874 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NRH 1.5 Å, Crystal Structure of human PARP-1 ART domain bound inhibitor UTT63
9ETQ 1.59 Å, Crystal structure of PARP1 catalytic domain bound to AZD5305 (SARUPARIB)
7AAC 1.59 Å, Crystal structure of the catalytic domain of human PARP1 in complex with veliparib
6NRJ 1.65 Å, Crystal Structure of human PARP-1 ART domain bound to inhibitor UTT93
7KK2 1.7 Å, Structure of the catalytic domain of PARP1
2RIQ 1.7 Å, Crystal Structure of the Third Zinc-binding domain of human PARP-1
6NRG 1.7 Å, Crystal Structure of human PARP-1 ART domain bound to inhibitor UTT57
7KK5 1.7 Å, Structure of the catalytic domain of PARP1 in complex with niraparib
7AAA 1.74 Å, Crystal structure of the catalytic domain of human PARP1 (apo)
6NTU 1.8 Å, Crystal Structure of human PARP-1 ART domain bound to inhibitor UKTT-15
9ETR 1.82 Å, Crystal structure of PARP1 catalytic domain bound to AZD9574
7ONT 1.85 Å, PARP1 catalytic domain in complex with a selective pyridine carboxamide-based inhibitor…

Browse structure collections

About this viewer

MolViewer shows 9MJA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.