Vitamin K-dependent gamma-carboxylase with Osteocalcin (mutant) and vitamin K hydroquinone and calcium. Determined by electron microscopy at 3.37 Å resolution. Released 8 Oct 2025.
Explore 9MQB in 3D Show helices and sheets RCSB PDB PDBe
9MQB contains 45 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 33-38 | 6 | |
| α-helix | 42-45 | 4 | |
| α-helix | 48-55 | 8 | |
| β-strand | 58-59 | 2 | 1 |
| α-helix | 62-78 | 17 | |
| α-helix | 88-90 | 3 | |
| α-helix | 109-111 | 3 | |
| α-helix | 112-131 | 20 | |
| α-helix | 135-152 | 18 | |
| α-helix | 159-171 | 13 | |
| α-helix | 182-186 | 5 | |
| α-helix | 188-190 | 3 | |
| β-strand | 193 | 1 | 2 |
| β-strand | 195-196 | 2 | 1 |
| α-helix | 198-217 | 20 | |
| α-helix | 221-224 | 4 | |
| α-helix | 232-234 | 3 | |
| α-helix | 236-238 | 3 | |
| α-helix | 241-244 | 4 | |
| α-helix | 247-249 | 3 | |
| α-helix | 250-257 | 8 | |
| α-helix | 258-269 | 12 | |
| α-helix | 276-293 | 18 | |
| α-helix | 299-306 | 8 | |
| α-helix | 307-310 | 4 | |
| α-helix | 315-321 | 7 | |
| α-helix | 325-328 | 4 | |
| α-helix | 336-337 | 2 | |
| β-strand | 338 | 1 | 2 |
| α-helix | 339 | 1 | |
| α-helix | 351-356 | 6 | |
| α-helix | 359-376 | 18 | |
| α-helix | 377-379 | 3 | |
| α-helix | 385-387 | 3 | |
| β-strand | 406-416 | 11 | 3 |
| β-strand | 423-426 | 4 | 3 |
| α-helix | 441-454 | 14 | |
| α-helix | 455-458 | 4 | |
| β-strand | 464-473 | 10 | 3 |
| β-strand | 478 | 1 | 4 |
| β-strand | 479-480 | 2 | 3 |
| β-strand | 482 | 1 | 5 |
| β-strand | 502 | 1 | 5 |
| α-helix | 503-505 | 3 | |
| α-helix | 512-521 | 10 | |
| β-strand | 528-534 | 7 | 4 |
| β-strand | 539-543 | 5 | 6 |
| β-strand | 552-557 | 6 | 4 |
| β-strand | 560-564 | 5 | 6 |
| β-strand | 569-573 | 5 | 6 |
| β-strand | 578-580 | 3 | 4 |
| β-strand | 586-591 | 6 | 6 |
| β-strand | 597-603 | 7 | 4 |
| α-helix | 606-626 | 21 | |
| α-helix | 633-635 | 3 | |
| α-helix | 636-638 | 3 | |
| α-helix | 639-643 | 5 | |
| α-helix | 650-653 | 4 | |
| α-helix | 654-673 | 20 | |
| α-helix | 677-708 | 32 | |
| α-helix | 713-723 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-37 | 2 | 3 |
| α-helix | 39-42 | 4 | |
| β-strand | 65 | 1 | 3 |
| α-helix | 83-85 | 3 | |
| α-helix | 89-97 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Vitamin K-dependent gamma-carboxylase | A | protein | 758 | Homo sapiens | P38435 (AlphaFold model) |
| Osteocalcin | P | protein | 100 | Homo sapiens | P02818 (AlphaFold model) |
>9MQB_1 Vitamin K-dependent gamma-carboxylase (chains A) MAVSAGSARTSPSSDKVQKDKAELISGPRQDSRIGKLLGFEWTDLSSWRRLVTLLNRPTD PASLAVFRFLFGFLMVLDIPQERGLSSLDRKYLDGLDVCRFPLLDALRPLPLDWMYLVYT IMFLGALGMMLGLCYRISCVLFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFMDANHYW SVDGLLNAHRRNAHVPLWNYAVLRGQIFIVYFIAGVKKLDADWVEGYSMEYLSRHWLFSP FKLLLSEELTSLLVVHWGGLLLDLSAGFLLFFDVSRSIGLFFVSYFHCMNSQLFSIGMFS YVMLASSPLFCSPEWPRKLVSYCPRRLQQLLPLKAAPQPSVSCVYKRSRGKSGQKPGLRH QLGAAFTLLYLLEQLFLPYSHFLTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRT GELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQR IFDPRVDIVQAAWSPFQRTSWVQPLLMDLSPWRAKLQEIKSSLDNHTEVVFIADFPGLHL ENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYM YVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFL RRQQRLQEIERRRNTPFHERFFRFLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEV TYANLRPFEAVGELNPSNTDSSHSNPPESNPDPVHSEF
>9MQB_2 Osteocalcin (chains P) MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEASEVLKRPRRYLYQWLGAP VPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 3 |
| 6PL | (4S,7R)-4-hydroxy-n,n,n-trimethyl-9-oxo-7-[(palmitoyloxy)methyl]-3,5,8-trioxa-4… | C42 H85 N O8 P | 2 |
| A1AVC | vitamin K1 hydroquinone | C31 H48 O2 | 1 |
Structural insights into the vitamin K-dependent gamma-carboxylation of osteocalcin. Cao, Q., Fan, J., Ammerman, A. et al. Cell Res (2025) 35:735-749. DOI 10.1038/s41422-025-01161-0 · PubMed
Other PDB entries of the same protein (UniProt P38435 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9MQB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.