Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound SRM-26-100. Determined by X-ray diffraction at 1.43 Å resolution. Released 26 Mar 2025.
Explore 9N1T in 3D Show helices and sheets RCSB PDB PDBe
9N1T contains 16 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5 | 1 | 1 |
| α-helix | 9-11 | 3 | |
| β-strand | 13-21 | 9 | 1 |
| β-strand | 25-32 | 8 | 1 |
| β-strand | 38-45 | 8 | 1 |
| β-strand | 46 | 1 | 2 |
| α-helix | 47 | 1 | |
| β-strand | 56 | 1 | 2 |
| α-helix | 58-70 | 13 | |
| β-strand | 73 | 1 | 3 |
| β-strand | 76 | 1 | 3 |
| β-strand | 79-84 | 6 | 1 |
| β-strand | 88-94 | 7 | 1 |
| β-strand | 100 | 1 | 3 |
| α-helix | 101-107 | 7 | |
| α-helix | 109-112 | 4 | |
| α-helix | 113-132 | 20 | |
| β-strand | 135-136 | 2 | 4 |
| α-helix | 142-144 | 3 | |
| β-strand | 145-147 | 3 | 3 |
| β-strand | 157-159 | 3 | 3 |
| β-strand | 166-167 | 2 | 4 |
| β-strand | 173 | 1 | 5 |
| α-helix | 181-183 | 3 | |
| α-helix | 186-189 | 4 | |
| β-strand | 194 | 1 | 5 |
| α-helix | 197-212 | 16 | |
| α-helix | 222-230 | 9 | |
| α-helix | 238-241 | 4 | |
| α-helix | 246-253 | 8 | |
| α-helix | 260-262 | 3 | |
| α-helix | 264-265 | 2 | |
| α-helix | 266-271 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Death-associated protein kinase 1 | A | protein | 293 | Homo sapiens | P53355 (AlphaFold model) |
>9N1T_1 Death-associated protein kinase 1 (chains A) TVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDI EREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLK QILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGTP EFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEYF SNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSSAWSHPQFE
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1BU8 | 3-(4-methylpiperazin-1-yl)-5-(pyridin-4-yl)pyridazine | C14 H17 N5 | 1 |
Water and common crystallization additives (SO4) are not listed.
Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound SRM-26-100. Brunzelle, J.S., Shuvalova, L., Roy, S.M. et al. To be published.
Other PDB entries of the same protein (UniProt P53355 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9N1T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.