9N7Q: H1 hemagglutinin

H1 hemagglutinin (A/Michigan/45/2015) in complex with anchor-targeting Fab ST15. Determined by electron microscopy at 3.18 Å resolution. Released 18 Feb 2026.

Method: Electron microscopy
Resolution: 3.18 Å
Organisms: Homo sapiens, Influenza A virus
Chains: 12
Atoms: 17,391
Mol. weight: 270.58 kDa
Ligands: NAG
Released: 18 Feb 2026

Explore 9N7Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9N7Q contains 36 α-helices and 204 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains a, b and c: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	22
β-strand	13	1	21
β-strand	14	1	8
β-strand	22-26	5	7
β-strand	33-34	2	7
α-helix	38-57	20
α-helix	75-126	52
α-helix	127-129	3
β-strand	130-132	3	7
β-strand	135	1	22
β-strand	137-140	4	7
α-helix	146-154	9
α-helix	159-172	14

Chains A, B and C: 5 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	12-17	6	7
β-strand	18	1	8
β-strand	24-26	3	9
β-strand	34-36	3	9
β-strand	39-41	3	10
β-strand	43-44	2	11
β-strand	51-54	4	12
β-strand	57	1	12
β-strand	60-63	4	13
α-helix	67-71	5
β-strand	85	1	14
β-strand	89-91	3	13
α-helix	108-114	7
β-strand	118	1	15
β-strand	119	1	14
β-strand	137	1	16
β-strand	158-160	3	17
β-strand	162	1	16
β-strand	171-176	6	18
β-strand	182-189	8	17
α-helix	195-201	7
β-strand	209-213	5	18
β-strand	217-220	4	18
β-strand	230	1	19
β-strand	233	1	19
α-helix	237	1
β-strand	238-244	7	17
β-strand	249-254	6	18
β-strand	259-261	3	17
β-strand	265-267	3	17
β-strand	269	1	15
β-strand	275-277	3	13
β-strand	282-287	6	12
β-strand	289-290	2	20
β-strand	296	1	20
β-strand	302-303	2	11
β-strand	310-311	2	20
α-helix	313-314	2
β-strand	315-316	2	11
β-strand	323-325	3	10
β-strand	329	1	9
β-strand	332	1	21

Chains D, E and H: 0 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	45
β-strand	12	1	46
β-strand	19-25	7	45
β-strand	32-39	8	47
β-strand	45-51	7	47
β-strand	57-59	3	47
β-strand	68-72	5	45
β-strand	77-81	5	45
β-strand	90	1	48
β-strand	92-98	7	47
β-strand	109	1	48
β-strand	112	1	46

Chains F, G and L: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	49
β-strand	10-12	3	50
β-strand	19-29	11	49
β-strand	34-38	5	50
β-strand	44-49	6	50
β-strand	53-54	2	50
β-strand	63-66	4	49
β-strand	68-75	8	49
α-helix	80-82	3
β-strand	85-89	5	50
β-strand	99	1	50
α-helix	100-102	3
β-strand	103-106	4	50

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ST15 Heavy Chain Fab	D, E, H	protein	123	Homo sapiens	P01764 (AlphaFold model)
ST15 Light Chain Fab	F, G, L	protein	108	Homo sapiens	A0A5C2GRD9 (AlphaFold model)
H1 HA1	A, B, C	protein	344	Influenza A virus	A0A346HA40
H1 HA2	a, b, c	protein	220	Influenza A virus	A0A6M4YP75

Sequence of entity 1 (D, E, H), FASTA

>9N7Q_1 ST15 Heavy Chain Fab (chains D, E, H)
EVQLLESGGGLVQPGGSLRLSCAASGFTFNSYGMSWVRQAPGKGLEWVSAISGSGISTYY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGGRDYQPYFYSMDVWGQGTTVT
VSS

Sequence of entity 2 (F, G, L), FASTA

>9N7Q_2 ST15 Light Chain Fab (chains F, G, L)
EIVMTQSPATLSVSPGERATLSCRASQSISSSLAWYQQKPGQSPRLLIYGASTRATGIPA
RFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPLTFGGGTRVEIK

Sequence of entity 3 (A, B, C), FASTA

>9N7Q_3 H1 HA1 (chains A, B, C)
MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK
LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSNSDNGTCYPGDFINYEELRE
QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLNQ
SYINDKGKEVLVLWGIHHPSTTADQQSLYQNADAYVFVGTSRYSKKFKPEIATRPKVRDQ
EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFTMERNAGSGIIISDTPVHDCNTTCQTPE
GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSR

Sequence of entity 4 (a, b, c), FASTA

>9N7Q_4 H1 HA2 (chains a, b, c)
GLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDKITNKVNSVIEKMN
TQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYE
KVRNQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREKIDGVGYIP
EAPRDGQAYVRKDGEWVLLSTFLGSENLYFQGGSHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	18

Primary citation

Individualized IG genotyping coupled with high throughput isolation of influenza HA-specific monoclonal antibodies. Fisher, A., Corcoran, M., Chernyshev, M. et al. To be published.

Other PDB entries of the same protein (UniProt P01764 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZHD 1.96 Å, The crystal structure of single domain antibody 8-4 scaffold.
3ZHK 1.96 Å, The crystal structure of single domain antibody 2x1 scaffold
1OHQ 2.0 Å, Crystal structure of HEL4, a soluble human VH antibody domain resistant to aggregation
3ZHL 2.47 Å, The crystal structure of single domain antibody 8-14 scaffold
3UPC 2.8 Å, A general strategy for the generation of human antibody variable domains with increased…
4KFZ 2.8 Å, Crystal structure of LMO2 and anti-LMO2 VH complex

Browse structure collections

About this viewer

MolViewer shows 9N7Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.