9O9T: Human MPC IMS-open

Structure of human MPC IMS-open. Determined by electron microscopy at 3.31 Å resolution. Released 30 Jul 2025.

Method: Electron microscopy
Resolution: 3.31 Å
Organisms: Homo sapiens, Escherichia coli K-12
Chains: 2
Atoms: 5,222
Mol. weight: 83.86 kDa
Released: 30 Jul 2025

Explore 9O9T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9O9T contains 40 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	25-44	20
α-helix	53-72	20
α-helix	78-93	16
β-strand	128-132	5	1
α-helix	139-152	14
β-strand	156-160	5	1
α-helix	165-173	9
β-strand	181-185	5	1
α-helix	186-188	3
α-helix	189-194	6
β-strand	198	1	2
α-helix	199-201	3
α-helix	205-210	6
β-strand	211	1	3
α-helix	213-217	5
β-strand	220-221	2	4
β-strand	224-225	2	4
β-strand	228-233	6	1
β-strand	236-240	5	5
β-strand	250	1	6
α-helix	253-262	10
β-strand	267-269	3	5
α-helix	276-286	11
β-strand	293-294	2	7
β-strand	297-298	2	7
α-helix	304-306	3
α-helix	308-322	15
α-helix	332-340	9
β-strand	344-349	6	5
α-helix	351-353	3
α-helix	354-359	6
β-strand	364-367	4	5
α-helix	368-370	3
β-strand	371	1	6
β-strand	372	1	8
β-strand	375	1	8
α-helix	376-377	2
β-strand	380-381	2	9
β-strand	382-388	7	1
β-strand	389	1	2
α-helix	395-400	6
α-helix	401-406	6
α-helix	409-418	10
β-strand	423-424	2	1
β-strand	426	1	3
α-helix	427-434	8
α-helix	437-448	12
β-strand	450-451	2	9
α-helix	452-453	2
α-helix	458-473	16
α-helix	479-486	8

Chain B: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	44-60	17
α-helix	64-66	3
α-helix	69-84	16
α-helix	94-136	43
α-helix	139-148	10
α-helix	162-169	8
α-helix	172-180	9
α-helix	195-201	7
α-helix	205-213	9
α-helix	228-235	8
α-helix	238-246	9
α-helix	261-268	8
α-helix	271-280	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitochondrial pyruvate carrier 2	B	protein	281	Homo sapiens	O95563 (AlphaFold model)
Mitochondrial pyruvate carrier 1/MBP chimera protein	A	protein	487	Homo sapiens, Escherichia coli K-12	Q9Y5U8 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>9O9T_1 Mitochondrial pyruvate carrier 2 (chains B)
MSAAGARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADM
ARPAEKLSTAQSAVLMATGFIFSRYSLVIIPKNWSLFAVNFFVGAAGASQLFRIWRYNQE
LKAKDLGRKLLEAARAGQLDEVRILLANGADVNAADNTGTTPLHLAAYSGHLEIVEVLLK
HGADVDASDVFGYTPLHLAAYWGHLEIVEVLLKNGADVNAMDSDGMTPLHLAAKWGYLEI
VEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN

Sequence of entity 2 (A), FASTA

>9O9T_2 Mitochondrial pyruvate carrier 1/MBP chimera protein (chains A)
MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALC
CYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASAGGGGSGGGGSG
GGGSEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPD
IIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYN
KDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDI
KDVGVDNAGAKAGLTFLIDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTS
KVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKP
LGAVALKSYEEELVKDPRVAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVD
AALAAAQ

Primary citation

Structure of human mitochondrial pyruvate carrier MPC1 and MPC2 complex. Sun, Y., Wang, Y., Xing, Z. et al. Nat Commun (2025) 16:6700-6700. DOI 10.1038/s41467-025-61939-z · PubMed

Other PDB entries of the same protein (UniProt O95563 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9MNZ 2.73 Å, Cryo-EM structure of human MPC in complex with UK5099 in nanodiscs
9MNY 2.78 Å, Cryo-EM structure of human MPC with pyruvate
9MO0 2.83 Å, Cryo-EM structure of human MPC in complex with AKOS005153046
8YW9 3.01 Å, Cryo-EM structure of human mitochondrial pyruvate carrier in the matrix-facing…
9MNX 3.11 Å, Cryo-EM structure of human MPC in complex with UK5099 in LMNG
8YW8 3.17 Å, Cryo-EM structure of human mitochondrial pyruvate carrier in complex with the inhibitor…
8YW6 3.18 Å, Cryo-EM structure of apo human mitochondrial pyruvate carrier in the IMS-open…
9MNW 3.35 Å, Cryo-EM structure of human MPC in complex with GW604714
9KNY 3.4 Å, Cryo-EM structure of pyruvate-treated human mitochondrial pyruvate carrier in the…
9KNW 3.41 Å, Cryo-EM structure of apo human mitochondrial pyruvate carrier in the IMS-open…
9O9S 3.57 Å, Structure of human MPC matrix-open
9GIV 3.65 Å, Structure of the human mitochondrial pyruvate carrier inhibited by a UK5099-derivative

Browse structure collections

About this viewer

MolViewer shows 9O9T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.