9OIJ: S. Typhimurium 14028 Gifsy-1 prophage HepS

Structure of S. Typhimurium 14028 Gifsy-1 prophage HepS. Determined by X-ray diffraction at 2.05 Å resolution. Released 28 Jan 2026.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Salmonella enterica subsp. enterica serovar Typhimurium str. ATCC 14028
Chains: 2
Atoms: 3,074
Mol. weight: 47.87 kDa
Released: 28 Jan 2026

Explore 9OIJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9OIJ contains 23 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	24-26	3
α-helix	28-32	5
α-helix	36-58	23
α-helix	60	1
α-helix	73-82	10
α-helix	87-105	19
α-helix	113-123	11
α-helix	128-131	4
α-helix	139-148	10
α-helix	149-152	4
α-helix	168-194	27

Chain B: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	24-26	3
α-helix	28-31	4
α-helix	36-58	23
α-helix	60	1
α-helix	73-82	10
α-helix	87-105	19
α-helix	113-123	11
α-helix	128-131	4
α-helix	139-148	10
α-helix	149-152	4
α-helix	154-157	4
α-helix	165-195	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HepS	A, B	protein	212	Salmonella enterica subsp. enterica serovar Typhimurium str. ATCC 14028	A0A0F6B549 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9OIJ_1 HepS (chains A, B)
GSMKYSRVEQSTGTSIDHNLGYFLDPQKYVPITEFVDESAALIKLNLIHENFLSIVIENL
RREGTEKFVDVDKYFMPKIKTAVALGLPVSLAKCLTEMNNIRNKYAHKIEYIITDEDAER
IDSLIMSVPVDDINHASLIDSTLITSITNLGASSIAFMNDIPKDFPDNRRRICKLVAMAF
CISNLGAFWLLNELHRQGKLKMGSTKMAFKPS

Primary citation

A prophage-encoded abortive infection protein preserves host and prophage spread. Sargen, M.R., Antine, S.P., Grabe, G.J. et al. Nature (2026) 652:201-208. DOI 10.1038/s41586-025-10070-6 · PubMed

Other PDB entries of the same protein (UniProt A0A0F6B549 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OIK 1.86 Å, Structure of S. Typhimurium 14028 Gifsy-1 prophage HepS bound to bacteriophage lambda J…

Browse structure collections

About this viewer

MolViewer shows 9OIJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.