9OKF: Human SV2A in the apo state

Cryo-EM structure of human SV2A in the apo state. Determined by electron microscopy at 2.8 Å resolution. Released 10 Dec 2025.

Method: Electron microscopy
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,753
Mol. weight: 67.82 kDa
Released: 10 Dec 2025

Explore 9OKF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9OKF contains 25 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	140-159	20
α-helix	163-197	35
α-helix	201-229	29
α-helix	231-251	21
α-helix	255-269	15
α-helix	272-281	10
α-helix	289-294	6
α-helix	295-297	3
α-helix	298-314	17
α-helix	318-320	3
β-strand	322-323	2	1
β-strand	329-330	2	1
α-helix	332-339	8
α-helix	342-351	10
α-helix	355-357	3
α-helix	358-363	6
α-helix	367-384	18
α-helix	416-437	22
α-helix	444-480	37
α-helix	596-606	11
α-helix	609-622	14
α-helix	624-640	17
α-helix	641-644	4
α-helix	648-675	28
α-helix	682-707	26
α-helix	714-730	17
α-helix	734-735	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Synaptic vesicle glycoprotein 2A	A	protein	604	Homo sapiens	Q7L0J3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9OKF_1 Synaptic vesicle glycoprotein 2A (chains A)
AQRRKEREELAQQYEAILRECGHGRFQWTLYFVLGLALMADGVEVFVVGFVLPSAEKDMC
LSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTF
LFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHY
GWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRFFLENGKHDEAWMVLKQVH
DTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSC
FGPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDYASRTKVFPGERVEHVTFN
FTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYN
TDLFEYKFVNSRLINSTFLHNKEGCPLDVTGTGEGAYMVYFVSFLGTLAVLPGNIVSALL
MDKIGRLRMLAGSSVMSCVSCFFLSFGNSESAMIALLCLFGGVSIASWNALDVLTVELYP
SDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFASAALALGSSLALKLPETRG
QVLQ

Primary citation

Structural pharmacology of SV2A reveals an allosteric modulation mechanism in the major facilitator superfamily. Pidathala, S., Chen, X., Dai, Y. et al. Nat Commun (2025) 16:10748-10748. DOI 10.1038/s41467-025-65781-1 · PubMed

Other PDB entries of the same protein (UniProt Q7L0J3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4V11 1.95 Å, Structure of Synaptotagmin-1 with SV2A peptide phosphorylated at Thr84
9OKH 2.39 Å, Cryo-EM structure of human SV2A in complex with UCBJ
9OKG 2.58 Å, Cryo-EM structure of human SV2A in complex with levetiracetam
9OKI 2.67 Å, Cryo-EM structure of human SV2A in complex with UCBJ and UCB1244283
9OKJ 2.68 Å, Cryo-EM structure of human SV2A in complex with padsevonil
8JLE 2.82 Å, Cryo-EM structure of SV2A LD4 in complex with BoNT/A2 Hc in the…
8JLG 2.87 Å, Cryo-EM structure of SV2A in complex with BoNT/A2 Hc
8JLC 2.88 Å, Cryo-EM structure of SV2A in complex with BoNT/A2 Hc and levetiracetam
8JS8 2.88 Å, Cryo-EM structure of SV2A in complex with BoNT/A2 Hc and levetiracetam
8JLH 2.9 Å, Cryo-EM structure of SV2A dimer in complex with BoNT/A2 Hc and levetiracetam
9PC9 2.91 Å, Structure of Synaptic Vesicle Protein 2A Bound to UCB7361
8JLF 3.01 Å, Cryo-EM structure of SV2A in complex with BoNT/A2 Hc

Browse structure collections

About this viewer

MolViewer shows 9OKF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.