9OUM: Gamma-aminobutyric acid receptor subunit beta-1

Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in complex with GABA and PZ-II-029. Determined by electron microscopy at 2.9 Å resolution. Released 18 Feb 2026.

Method: Electron microscopy
Resolution: 2.9 Å
Organisms: Rattus norvegicus, Mus musculus
Chains: 7
Atoms: 10,660
Mol. weight: 319.24 kDa
Ligands: ABU, NAG, A1CEP
Released: 18 Feb 2026

Explore 9OUM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9OUM contains 23 α-helices and 88 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	11-21	11
β-strand	38-53	16	9
β-strand	58-70	13	9
β-strand	82-85	4	9
α-helix	87-90	4
β-strand	98-100	3	10
β-strand	103	1	9
β-strand	107-108	2	9
β-strand	116-121	6	9
β-strand	125-137	13	9
β-strand	149-158	10	10
β-strand	166-170	5	9
α-helix	174-176	3
β-strand	178-180	3	9
β-strand	185	1	9
β-strand	190-203	14	10
β-strand	208-220	13	10

Chain B: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	9-20	12
α-helix	35	1
β-strand	36-47	12	1
β-strand	51	1	1
β-strand	56-68	13	1
α-helix	70-72	3
β-strand	81-83	3	1
α-helix	85-90	6
β-strand	96-98	3	2
β-strand	101-106	6	1
β-strand	114-118	5	1
β-strand	123-135	13	1
β-strand	147-156	10	2
β-strand	164-168	5	1
α-helix	171-174	4
β-strand	175-176	2	1
β-strand	186-200	15	2
β-strand	203-216	14	2

Chain C: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	10-20	11
α-helix	35-36	2
β-strand	37-52	16	13
β-strand	57-69	13	13
β-strand	81-84	4	13
α-helix	86-91	6
β-strand	97-99	3	14
β-strand	102	1	13
β-strand	106-107	2	13
β-strand	115-120	6	13
β-strand	124-136	13	13
β-strand	148-157	10	14
β-strand	165-169	5	13
β-strand	177-178	2	13
α-helix	181-183	3
β-strand	184	1	13
β-strand	189-202	14	14
β-strand	207-219	13	14

Chain D: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	26-35	10
α-helix	50	1
β-strand	51-66	16	3
β-strand	71-83	13	3
β-strand	95-99	5	3
α-helix	100-105	6
β-strand	111-113	3	4
β-strand	116-121	6	3
β-strand	129-134	6	3
β-strand	138-150	13	3
β-strand	162-171	10	4
β-strand	179-190	12	3
β-strand	201-214	14	4
β-strand	219-231	13	4

Chain E: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	8-20	13
α-helix	28	1
β-strand	36-51	16	11
β-strand	56-68	13	11
α-helix	70-72	3
β-strand	81-83	3	11
α-helix	85-90	6
β-strand	96-98	3	12
β-strand	101-106	6	11
β-strand	114-118	5	11
β-strand	123-135	13	11
β-strand	147-156	10	12
β-strand	164-168	5	11
α-helix	171-173	3
β-strand	175-176	2	11
β-strand	186-200	15	12
β-strand	203-216	14	12

Chain H: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	5
β-strand	10-12	3	6
β-strand	17-25	9	5
α-helix	29-31	3
β-strand	34-39	6	6
β-strand	45-51	7	6
β-strand	57-59	3	6
α-helix	61-63	3
β-strand	64	1	5
β-strand	67-72	6	5
β-strand	77-82A	7	5
β-strand	88-95	8	6
β-strand	100A-103	4	6
β-strand	107-111	5	6

Chain L: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	7
β-strand	10-12	3	8
β-strand	19-25	7	7
β-strand	33-38	6	8
β-strand	45-49	5	8
β-strand	53-54	2	8
β-strand	62-66	5	7
β-strand	70-75	6	7
α-helix	80-82	3
β-strand	85-90	6	8
β-strand	96-97	2	8
β-strand	98	1	7
β-strand	101-104	4	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit beta-1	B	protein	474	Rattus norvegicus	P15431 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	D	protein	466	Rattus norvegicus	P18508 (AlphaFold model)
8E3 Fab heavy chain	H	protein	223	Mus musculus
8E3 Fab light chain	L	protein	213	Mus musculus
Gamma-aminobutyric acid receptor subunit alpha-1	A	protein	455	Rattus norvegicus	P62813 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-2	E	protein	474	Rattus norvegicus	P63138 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit alpha-6	C	protein	453	Rattus norvegicus	P30191

Sequence of entity 1 (B), FASTA

>9OUM_1 Gamma-aminobutyric acid receptor subunit beta-1 (chains B)
MWTVQNRESLGLLSFPVMVAMVCCAHSSNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPP
VDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLK
RNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKI
PYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANEKNKLEMNKVQ
VDAHGNILLSTLEIRNETSGSEVLTGVSDPKATMYSYDSASIQYRKPLSSREGFGRGLDR
HGVPGKGRIRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYYVH

Sequence of entity 2 (D), FASTA

>9OUM_2 Gamma-aminobutyric acid receptor subunit gamma-2 (chains D)
MSSPNTWSTGSTVYSPVFSQKMTLWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPKV
PEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTW
YDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYT
LRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFS
FVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAV
PARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVS
NRKPSKDKDKKKKNPAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCF
EDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL

Sequence of entity 3 (H), FASTA

>9OUM_3 8E3 Fab heavy chain (chains H)
EIQLQQSGPELVKPGTSVKVSCKASGYSFTDYNMYWVKQSHGKSLEWIGYIDPYNADTTY
NREFKGKATLTVDKSSSTAFMHLNSLTSEDSAVYYCARKRNNFYFDYWGQGTPLTVSSAK
TTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLY
TMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKSAALEVLFQ

Sequence of entity 4 (L), FASTA

>9OUM_4 8E3 Fab light chain (chains L)
YIVMTQSPKSMSMSLGERVTLSCRASEYVGSYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFAGSGSATDFTLTITSVQAEDLADYHCGQTYNYPTFGGGTKLEIKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 5 (A), FASTA

>9OUM_5 Gamma-aminobutyric acid receptor subunit alpha-1 (chains A)
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ

Sequence of entity 6 (E), FASTA

>9OUM_6 Gamma-aminobutyric acid receptor subunit beta-2 (chains E)
MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPV
AVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDT
YFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIES
YGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKR
NIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIP
YVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAANANNEKMRLDVNKM
DPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALER
HVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN

Sequence of entity 7 (C), FASTA

>9OUM_7 Gamma-aminobutyric acid receptor subunit alpha-6 (chains C)
MLLLLPWLFSLLWIENAQAQLEDEGNFYSENVSRILDNLLEGYDNRLRPGFGGAVTEVKT
DIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLKFKGPAEILSLNNLMVSKIWTPDTFFRN
GKKSIAHNMTTPNKLFRLMHNGTILYTMRLTINADCPMRLVNFPMDGHACPLKFGSYAYP
KSEIIYTWKKGPLYSVEVPEESSSLLQYDLIGQTVSSETIKSNTGEYVIMTVYFHLQRKM
GYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHSLPKVSYA
TAMDWFIAVCFAFVFSALIEFAAVNYFTNLQSQKAERQAQTAAKPPVAKSKTTESLEAEI
VVHSDSKYHLKKRISSLTLPIVPSSEASKVLSRTPILPSTPVTPPLLLPAIGGTSKIDQY
SRILFPVAFAGFNLVYWIVYLSKDTMEVSSTVE

Ligands and cofactors

ID	Name	Formula	Copies
ABU	Gamma-amino-butanoic acid	C4 H9 N O2	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1
A1CEP	7-methoxy-2-(4-methoxyphenyl)-1,2-dihydro-3H-pyrazolo[4,3-c]quinolin-3-one	C18 H15 N3 O3	1

Primary citation

Molecular assemblies and pharmacology of cerebellar GABA A receptors. Sun, C., Jahncke, J.N., Wright, K.M. et al. Proc Natl Acad Sci U S A (2026) 123:e2524504123-e2524504123. DOI 10.1073/pnas.2524504123 · PubMed

Other PDB entries of the same protein (UniProt P15431 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OUP 2.82 Å, Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in…
9OUQ 2.89 Å, Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in…
9OUO 2.92 Å, Native GABA-A receptor from rat cerebella, beta1-alpha1-beta1-alpha1-gamma2 subtype, in…
9OV4 2.93 Å, Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in…
6DW1 3.1 Å, Cryo-EM structure of the benzodiazepine-sensitive alpha1beta1gamma2S tri-heteromeric…
6DW0 3.8 Å, Cryo-EM structure of the benzodiazepine-sensitive alpha1beta1gamma2S tri-heteromeric…

Browse structure collections

About this viewer

MolViewer shows 9OUM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.