9OYI: DNA polymerase III subunit delta
Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped DNA in state 2 conformer 1 with fully open clamp and unsettled DNA. Determined by electron microscopy at 2.54 Å resolution. Released 29 Apr 2026.
- Method
- Electron microscopy
- Resolution
- 2.54 Å
- Organisms
- Escherichia coli, DNA molecule
- Chains
- 10
- Atoms
- 20,794
- Mol. weight
- 409.34 kDa
- Ligands
- AGS, ZN, MG
- Released
- 29 Apr 2026
Explore 9OYI in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9OYI contains 150 α-helices and 99 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 23 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-4 | 3 | 1 |
| α-helix | 6-8 | 3 | |
| α-helix | 9-14 | 6 | |
| β-strand | 20-24 | 5 | 1 |
| α-helix | 28-44 | 17 | |
| β-strand | 47-54 | 8 | 1 |
| α-helix | 61-69 | 9 | |
| β-strand | 70 | 1 | 2 |
| α-helix | 71-72 | 2 | |
| β-strand | 77-83 | 7 | 1 |
| α-helix | 91-101 | 11 | |
| β-strand | 108-114 | 7 | 1 |
| α-helix | 116-118 | 3 | |
| α-helix | 119-122 | 4 | |
| α-helix | 125-129 | 5 | |
| β-strand | 134-138 | 5 | 1 |
| α-helix | 140-143 | 4 | |
| α-helix | 147-157 | 11 | |
| β-strand | 161-162 | 2 | 3 |
| α-helix | 164-173 | 10 | |
| α-helix | 178-191 | 14 | |
| β-strand | 196-197 | 2 | 3 |
| α-helix | 199-203 | 5 | |
| α-helix | 214-223 | 10 | |
| α-helix | 226-239 | 14 | |
| α-helix | 243-263 | 21 | |
| α-helix | 269-275 | 7 | |
| α-helix | 280-282 | 3 | |
| α-helix | 283-292 | 10 | |
| α-helix | 295-314 | 20 | |
| α-helix | 321-331 | 11 | |
| α-helix | 339-342 | 4 | |
Chain B: 27 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 15-17 | 3 | |
| α-helix | 22-34 | 13 | |
| β-strand | 40-45 | 6 | 4 |
| α-helix | 51-63 | 13 | |
| α-helix | 77-84 | 8 | |
| β-strand | 90-94 | 5 | 4 |
| α-helix | 101-109 | 9 | |
| α-helix | 110-112 | 3 | |
| β-strand | 113 | 1 | 5 |
| α-helix | 114-115 | 2 | |
| β-strand | 121-126 | 6 | 4 |
| α-helix | 128-130 | 3 | |
| α-helix | 133-144 | 12 | |
| β-strand | 150-156 | 7 | 4 |
| α-helix | 159-161 | 3 | |
| α-helix | 164-168 | 5 | |
| β-strand | 171-175 | 5 | 4 |
| α-helix | 176-179 | 4 | |
| α-helix | 180-194 | 15 | |
| β-strand | 198 | 1 | 6 |
| α-helix | 200-210 | 11 | |
| α-helix | 214-228 | 15 | |
| β-strand | 232 | 1 | 6 |
| α-helix | 234-243 | 10 | |
| α-helix | 248-257 | 10 | |
| α-helix | 261-273 | 13 | |
| α-helix | 278-297 | 20 | |
| α-helix | 299-301 | 3 | |
| α-helix | 304-306 | 3 | |
| α-helix | 310-319 | 10 | |
| α-helix | 322-338 | 17 | |
| α-helix | 339-341 | 3 | |
| α-helix | 345-358 | 14 | |
| β-strand | 359-361 | 3 | 7 |
| α-helix | 362-364 | 3 | |
Chain C: 26 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 15-17 | 3 | |
| α-helix | 22-34 | 13 | |
| β-strand | 40-44 | 5 | 8 |
| α-helix | 51-63 | 13 | |
| α-helix | 77-84 | 8 | |
| β-strand | 90-94 | 5 | 8 |
| α-helix | 101-108 | 8 | |
| α-helix | 114-115 | 2 | |
| β-strand | 121-126 | 6 | 8 |
| α-helix | 128-130 | 3 | |
| α-helix | 133-144 | 12 | |
| β-strand | 150-156 | 7 | 8 |
| α-helix | 159-161 | 3 | |
| α-helix | 164-168 | 5 | |
| β-strand | 171-174 | 4 | 8 |
| α-helix | 175-179 | 5 | |
| α-helix | 180-194 | 15 | |
| β-strand | 198 | 1 | 9 |
| α-helix | 200-210 | 11 | |
| α-helix | 214-228 | 15 | |
| β-strand | 232 | 1 | 9 |
| α-helix | 234-241 | 8 | |
| α-helix | 246-258 | 13 | |
| α-helix | 261-272 | 12 | |
| α-helix | 278-297 | 20 | |
| α-helix | 299-301 | 3 | |
| α-helix | 304-306 | 3 | |
| α-helix | 310-319 | 10 | |
| α-helix | 322-338 | 17 | |
| α-helix | 339-341 | 3 | |
| α-helix | 345-358 | 14 | |
| α-helix | 365-368 | 4 | |
Chain D: 25 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 15-17 | 3 | |
| α-helix | 22-34 | 13 | |
| β-strand | 40-44 | 5 | 10 |
| α-helix | 51-63 | 13 | |
| α-helix | 77-84 | 8 | |
| β-strand | 90-94 | 5 | 10 |
| α-helix | 101-110 | 10 | |
| β-strand | 113 | 1 | 11 |
| α-helix | 114-115 | 2 | |
| β-strand | 121-126 | 6 | 10 |
| α-helix | 128-130 | 3 | |
| α-helix | 133-144 | 12 | |
| β-strand | 150-156 | 7 | 10 |
| α-helix | 159-161 | 3 | |
| α-helix | 164-169 | 6 | |
| β-strand | 171-174 | 4 | 10 |
| α-helix | 175-179 | 5 | |
| α-helix | 180-194 | 15 | |
| β-strand | 198 | 1 | 12 |
| α-helix | 200-210 | 11 | |
| α-helix | 214-227 | 14 | |
| β-strand | 232 | 1 | 12 |
| α-helix | 234-241 | 8 | |
| α-helix | 246-258 | 13 | |
| α-helix | 261-273 | 13 | |
| α-helix | 278-297 | 20 | |
| α-helix | 299-301 | 3 | |
| α-helix | 304-306 | 3 | |
| α-helix | 310-319 | 10 | |
| α-helix | 322-337 | 16 | |
| α-helix | 339-341 | 3 | |
| α-helix | 345-357 | 13 | |
Chain E: 21 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-19 | 13 | |
| β-strand | 26-30 | 5 | 13 |
| α-helix | 37-48 | 12 | |
| β-strand | 54 | 1 | 14 |
| β-strand | 57 | 1 | 14 |
| α-helix | 63-70 | 8 | |
| β-strand | 76-79 | 4 | 13 |
| β-strand | 88 | 1 | 15 |
| α-helix | 90-99 | 10 | |
| β-strand | 102 | 1 | 16 |
| β-strand | 110-114 | 5 | 13 |
| α-helix | 117-119 | 3 | |
| β-strand | 120 | 1 | 15 |
| α-helix | 122-133 | 12 | |
| α-helix | 135-136 | 2 | |
| β-strand | 139-145 | 7 | 13 |
| α-helix | 148-150 | 3 | |
| α-helix | 153-158 | 6 | |
| β-strand | 160-163 | 4 | 13 |
| α-helix | 165-168 | 4 | |
| α-helix | 169-177 | 9 | |
| α-helix | 184-193 | 10 | |
| α-helix | 198-203 | 6 | |
| α-helix | 209-226 | 18 | |
| α-helix | 229-232 | 4 | |
| α-helix | 233-236 | 4 | |
| α-helix | 241-259 | 19 | |
| α-helix | 271-280 | 10 | |
| α-helix | 283-302 | 20 | |
| α-helix | 308-322 | 15 | |
| α-helix | 327-330 | 4 | |
Chain F: 14 helices, 27 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-6 | 5 | 17 |
| α-helix | 7-17 | 11 | |
| α-helix | 28-31 | 4 | |
| β-strand | 32-38 | 7 | 18 |
| β-strand | 41-47 | 7 | 18 |
| β-strand | 51-58 | 8 | 18 |
| β-strand | 64 | 1 | 17 |
| β-strand | 66-71 | 6 | 18 |
| α-helix | 72-81 | 10 | |
| α-helix | 83 | 1 | |
| β-strand | 87-93 | 7 | 17 |
| β-strand | 96-101 | 6 | 17 |
| β-strand | 104-109 | 6 | 17 |
| β-strand | 111 | 1 | 18 |
| α-helix | 113-115 | 3 | |
| β-strand | 126-130 | 5 | 18 |
| α-helix | 132-142 | 11 | |
| α-helix | 143-145 | 3 | |
| α-helix | 153-155 | 3 | |
| β-strand | 158-172 | 15 | 5 |
| β-strand | 176-195 | 20 | 5 |
| α-helix | 197-206 | 10 | |
| α-helix | 213 | 1 | |
| β-strand | 214-218 | 5 | 18 |
| β-strand | 222-227 | 6 | 18 |
| β-strand | 230-235 | 6 | 18 |
| α-helix | 236 | 1 | |
| β-strand | 237 | 1 | 5 |
| β-strand | 254-258 | 5 | 5 |
| α-helix | 260-273 | 14 | |
| β-strand | 280-286 | 7 | 19 |
| β-strand | 289-294 | 6 | 19 |
| β-strand | 303-307 | 5 | 19 |
| β-strand | 309-310 | 2 | 5 |
| β-strand | 315-320 | 6 | 19 |
| α-helix | 321-331 | 11 | |
| β-strand | 336-340 | 5 | 5 |
| β-strand | 347-349 | 3 | 5 |
| β-strand | 357-361 | 5 | 5 |
| α-helix | 362-363 | 2 | |
| β-strand | 364 | 1 | 2 |
Chain G: 12 helices, 28 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-6 | 5 | 20 |
| α-helix | 7-17 | 11 | |
| α-helix | 30-32 | 3 | |
| β-strand | 34-38 | 5 | 21 |
| β-strand | 41-47 | 7 | 21 |
| β-strand | 51-58 | 8 | 21 |
| β-strand | 64 | 1 | 20 |
| β-strand | 66-68 | 3 | 21 |
| β-strand | 69 | 1 | 22 |
| α-helix | 72-80 | 9 | |
| β-strand | 87-92 | 6 | 20 |
| β-strand | 97-101 | 5 | 20 |
| β-strand | 104-106 | 3 | 20 |
| β-strand | 111 | 1 | 22 |
| β-strand | 126-130 | 5 | 21 |
| α-helix | 132-143 | 12 | |
| α-helix | 153-155 | 3 | |
| β-strand | 157-172 | 16 | 23 |
| β-strand | 176-196 | 21 | 23 |
| α-helix | 197-206 | 10 | |
| α-helix | 213 | 1 | |
| β-strand | 214-218 | 5 | 21 |
| β-strand | 222-227 | 6 | 21 |
| β-strand | 230-235 | 6 | 21 |
| α-helix | 236 | 1 | |
| β-strand | 237 | 1 | 16 |
| α-helix | 244-247 | 4 | |
| β-strand | 254-259 | 6 | 23 |
| α-helix | 260-270 | 11 | |
| β-strand | 280-286 | 7 | 17 |
| β-strand | 289-295 | 7 | 17 |
| β-strand | 301-306 | 6 | 17 |
| β-strand | 309 | 1 | 23 |
| β-strand | 315-320 | 6 | 17 |
| α-helix | 321-331 | 11 | |
| β-strand | 335-340 | 6 | 23 |
| α-helix | 346 | 1 | |
| β-strand | 347-351 | 5 | 23 |
| β-strand | 357-361 | 5 | 23 |
| β-strand | 364 | 1 | 11 |
Chain J: 2 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-11 | 8 | |
| β-strand | 17-19 | 3 | 7 |
| α-helix | 22-24 | 3 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| DNA polymerase III subunit delta | A | protein | 343 | Escherichia coli | P28630 (AlphaFold model) |
| DNA polymerase III subunit tau | B, C, D | protein | 643 | Escherichia coli | P06710 (AlphaFold model) |
| DNA polymerase III subunit delta' | E | protein | 334 | Escherichia coli | P28631 (AlphaFold model) |
| Beta sliding clamp | F, G | protein | 366 | Escherichia coli | P0A988 (AlphaFold model) |
| DNA polymerase III subunit psi | J | protein | 137 | Escherichia coli | P28632 |
| 10-nt gapped DNA template strand | H | DNA | 50 | DNA molecule | |
| 10-nt gapped DNA primer strand 1 | I | NA-hybrid | 20 | DNA molecule | |
Sequence of entity 1 (A), FASTA
>9OYI_1 DNA polymerase III subunit delta (chains A)
MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAVRQVAAAQGFEEHHTFSIDPNTD
WNAIFSLCQAMSLFASRQTLLLLLPENGPNAAINEQLLTLTGLLHDDLLLIVRGNKLSKA
QENAAWFTALANRSVQVTCQTPEQAQLPRWVAARAKQLNLELDDAANQVLCYCYEGNLLA
LAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALLMGKSKRALHILQQLRLEG
SEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQNRRGMMGEALNRLSQTQLRQ
AVQLLTRTELTLKQDYGQSVWAELEGLSLLLCHKPLADVFIDG
Sequence of entity 2 (B, C, D), FASTA
>9OYI_2 DNA polymerase III subunit tau (chains B, C, D)
MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAK
GLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRF
KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDV
EQIRHQLEHILNEEHIAHEPRALQLLARAAEGSLRDALSLTDQAIASGDGQVSTQAVSAM
LGTLDDDQALSLVEAMVEANGERVMALINEAAARGIEWEALLVEMLGLLHRIAMVQLSPA
ALGNDMAAIELRMRELARTIPPTDIQLYYQTLLIGRKELPYAPDRRMGVEMTLLRALAFH
PRMPLPEPEVPRQSFAPVAPTAVMTPTQVPPQPQSAPQQAPTVPLPETTSQVLAARQQLQ
RVQGATKAKKSEPAAATRARPVNNAALERLASVTDRVQARPVPSALEKAPAKKEAYRWKA
TTPVMQQKEVVATPKALKKALEHEKTPELAAKLAAEAIERDPWAAQVSQLSLPKLVEQVA
LNAWKEESDNAVCLHLRSSQRHLNNRGAQQKLAEALSMLKGSTVELTIVEDDNPAVRTPL
EWRQAIYEEKLAQARESIIADNNIQTLRRFFDAELDEESIRPI
Sequence of entity 3 (E), FASTA
>9OYI_3 DNA polymerase III subunit delta' (chains E)
MRWYPWLRPDFEKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQPQGHKSCG
HCRGCQLMQAGTHPDYYTLAPEKGKNTLGVDAVREVTEKLNEHARLGGAKVVWVTDAALL
TDAAANALLKTLEEPPAETWFFLATREPERLLATLRSRCRLHYLAPPPEQYAVTWLSREV
TMSQDALLAALRLSAGSPGAALALFQGDNWQARETLCQALAYSVPSGDWYSLLAALNHEQ
APARLHWLATLLMDALKRHHGAAQVTNVDVPGLVAELANHLSPSRLQAILGDVCHIREQL
MSVTGINRELLITDLLLRIEHYLQPGVVLPVPHL
Sequence of entity 4 (F, G), FASTA
>9OYI_4 Beta sliding clamp (chains F, G)
MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALV
QPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLD
DWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVC
SMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGR
FPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQE
EAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYV
VMPMRL
Sequence of entity 5 (J), FASTA
>9OYI_5 DNA polymerase III subunit psi (chains J)
MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRA
LTVSPDQVLQLTPEKIAMLPQGSHCNSWRLGTDEPLSLEGAQVASPALTDLRANPTARAA
LWQQICTYEHDFFPRND
Sequence of entity 6 (H), FASTA
>9OYI_6 10-nt gapped DNA template strand (chains H)
CGGTATAGGCGATACGAATCTTTTTTTTTTCCGTATAGCCGTAGCGAGCC
Sequence of entity 7 (I), FASTA
>9OYI_7 10-nt gapped DNA primer strand 1 (chains I)
GGCTCGCTACGGCTATACGG
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| AGS | Phosphothiophosphoric acid-adenylate ester | C10 H16 N5 O12 P3 S | 3 |
| ZN | Zinc ion | Zn | 4 |
| MG | Magnesium ion | Mg | 3 |
Primary citation
The E. coli DnaX clamp loader sharply bends DNA to load beta-clamp at nicks and small gaps. Zheng, F., Yao, N.Y., Georgescu, R.E. et al. bioRxiv (2026). DOI 10.64898/2026.01.17.700081 · PubMed
Other PDB entries of the same protein (UniProt P28630 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1JQL 2.5 Å, Mechanism of Processivity Clamp Opening by the Delta Subunit Wrench of the Clamp Loader…
- 9OYJ 2.53 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 9OYH 2.54 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 8GJ2 2.6 Å, E. coli clamp loader with closed clamp on primed template DNA
- 9OYK 2.6 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 9OYM 2.6 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 1JR3 2.7 Å, Crystal Structure of the Processivity Clamp Loader Gamma Complex of E. coli DNA…
- 8GIZ 2.7 Å, E. coli clamp loader with open clamp
- 9OYN 2.7 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 9OYC 2.71 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 1-nt gapped…
- 9OYE 2.72 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 1-nt gapped…
- 9OYD 2.73 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 1-nt gapped…
Browse structure collections
About this viewer
MolViewer shows 9OYI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.