9P0N: MscS in Glyco-DIBMA Native Nanodiscs

MscS in Glyco-DIBMA Native Nanodiscs (C7 symmetry). Determined by electron microscopy at 2.99 Å resolution. Released 28 Jan 2026.

Method: Electron microscopy
Resolution: 2.99 Å
Organism: Escherichia coli
Chains: 7
Atoms: 15,393
Mol. weight: 241.16 kDa
Ligands: D21
Released: 28 Jan 2026

Explore 9P0N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9P0N contains 63 α-helices and 63 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F and G: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	21-59	39
α-helix	68-89	22
α-helix	94-109	16
α-helix	112-126	15
β-strand	135-138	4	1
β-strand	141-148	8	1
β-strand	152-156	5	1
β-strand	162-166	5	1
α-helix	167-170	4
β-strand	175-177	3	1
β-strand	183-192	10	2
α-helix	198-211	14
β-strand	221-228	8	2
β-strand	233-242	10	2
α-helix	243-245	3
α-helix	246-264	19
α-helix	268-271	4
β-strand	272-279	8	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small-conductance mechanosensitive channel	A, B, C, D, E, F, G	protein	292	Escherichia coli	P0C0S2 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>9P0N_1 Small-conductance mechanosensitive channel (chains A, B, C, D, E, F, G)
MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK
IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA
GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR
EPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVW
SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAAHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
D21	(2R)-1-(hexadecanoyloxy)-3-(phosphonooxy)propan-2-yl (9Z)-octadec-9-enoate	C37 H71 O8 P	28

Primary citation

The lipid-mediated mechanism of mechanosensitive channel MscS inactivation. Moller, E., Britt, M., Zhou, F. et al. bioRxiv (2025). DOI 10.1101/2024.01.22.576751 · PubMed

Browse structure collections

About this viewer

MolViewer shows 9P0N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.