9P1F: Myoglobin variant RR22

Myoglobin variant RR22 in complex with imidazole. Determined by X-ray diffraction at 1.1 Å resolution. Released 4 Feb 2026.

Method: X-ray diffraction
Resolution: 1.1 Å
Organism: Physeter macrocephalus
Chains: 1
Atoms: 1,835
Mol. weight: 18.58 kDa
Ligands: HEM
Released: 4 Feb 2026

Explore 9P1F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9P1F contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	4-17	14
α-helix	18-20	3
α-helix	21-35	15
α-helix	37-42	6
α-helix	52-57	6
α-helix	59-77	19
α-helix	83-91	9
α-helix	92-96	5
α-helix	101-118	18
α-helix	125-149	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myoglobin	A	protein	154	Physeter macrocephalus	P02185 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9P1F_1 Myoglobin (chains A)
MVLSEGEWQLVLHVWAKVEADVAGHGQDIVIRLVKSHPETLEKFDRFKHLKTEAEMKASE
DLKKVGVTFLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH
PGDFGADAQGAMNKALELFRKDIAAKYKELGYQG

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	1

Water and common crystallization additives (IMD, SO4) are not listed.

Primary citation

Computational design of generalist cyclopropanases with stereodivergent selectivity. Shen, Z., Siriboe, M.G., Ren, X. et al. Nat Commun (2026) 17:1620-1620. DOI 10.1038/s41467-026-68327-1 · PubMed

Other PDB entries of the same protein (UniProt P02185 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YCE 0.77 Å, Sperm whale myoglobin swMb
7VDN 0.93 Å, High resolution crystal structure of Sperm Whale Myoglobin in the carbonmonoxy form
1A6M 1.0 Å, Oxy-myoglobin, atomic resolution
1NAZ 1.04 Å, structure of microgravity-grown oxidized myoglobin mutant YQR (ISS8A)
8ESU 1.04 Å, Myoglobin variant Mb-imi complex
1A6K 1.1 Å, Aquomet-myoglobin, atomic resolution
2EKT 1.1 Å, Crystal structure of myoglobin reconstituted with 6-methyl-6-depropionatehemin
3O89 1.1 Å, Crystal Structure of Sperm Whale Myoglobin G65T
6M8F 1.1 Å, Engineered sperm whale myoglobin-based carbene transferase
4H07 1.14 Å, Complex of G65T Myoglobin with Phenol in its Proximal Cavity
1A6G 1.15 Å, Carbonmonoxy-myoglobin, atomic resolution
1A6N 1.15 Å, Deoxy-myoglobin, atomic resolution

Browse structure collections

About this viewer

MolViewer shows 9P1F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.