9PUE: Alpha Appendage of AP2

Structure of Alpha Appendage of AP2 bound to the FxDxF motif derived of CCDC32. Determined by X-ray diffraction at 1.91 Å resolution. Released 8 Apr 2026.

Method: X-ray diffraction
Resolution: 1.91 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,212
Mol. weight: 28.54 kDa
Released: 8 Apr 2026

Explore 9PUE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9PUE contains 10 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	696	1
β-strand	697	1	1
α-helix	698	1
α-helix	701-706	6
β-strand	714-718	5	2
β-strand	722-731	10	2
β-strand	734-743	10	2
β-strand	749	1	3
β-strand	750-757	8	1
α-helix	760-765	6
β-strand	766-770	5	2
α-helix	772-774	3
β-strand	777	1	3
β-strand	782-791	10	2
β-strand	800-807	8	1
β-strand	810-817	8	1
α-helix	822-825	4
β-strand	826-828	3	4
α-helix	833-840	8
α-helix	846-848	3
β-strand	849-855	7	4
α-helix	862-872	11
β-strand	875-877	3	4
β-strand	887-894	8	4
β-strand	899-909	11	4
β-strand	914-921	8	4
α-helix	924-935	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AP-2 complex subunit alpha-2	A	protein	244	Mus musculus	P17427 (AlphaFold model)
Coiled-coil domain-containing protein 32	P	protein	9	Mus musculus	Q8BS39 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9PUE_1 AP-2 complex subunit alpha-2 (chains A)
APLAPGSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTP
TLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNV
SVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGS
ALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELL
SEQF

Sequence of entity 2 (P), FASTA

>9PUE_2 Coiled-coil domain-containing protein 32 (chains P)
NAFSDSFMD

Primary citation

Structure of AP-2 alpha appendage bound to the FxDxF motif of CCDC32. Sloan, D.E., Matthews, A.E., Tedamrongwanish, T. et al. To be published.

Other PDB entries of the same protein (UniProt P17427 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KYF 1.22 Å, Ap-2 clathrin adaptor alpha-appendage in complex with EPS15 dpf peptide
1QTS 1.4 Å, Crystal structure of the ap-2 clathrin adaptor alpha-appendage
7OHI 1.41 Å, FCHO1-peptide-AP2 alpha ear complex
1QTP 1.6 Å, Crystal structure of the ap-2 clathrin adaptor alpha-appendage
2VJ0 1.6 Å, Crystal structure of the alpha-adaptin appendage domain, from the AP2 adaptor complex,…
1KYU 1.8 Å, Ap-2 clathrin adaptor alpha-appendage in complex with EPS15 dpf peptide
1B9K 1.9 Å, Alpha-adaptin appendage domain, from clathrin adaptor AP2
1W80 1.9 Å, Crystal structure of the alpha-adaptin appendage domain, from the AP2 adaptor complex,…
3HS8 1.9 Å, Intersectin 1-peptide-AP2 alpha ear complex
1KY6 2.0 Å, Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
1KYD 2.0 Å, Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
9PPP 2.1 Å, Structure of Alpha Appendage of AP2 bound to the extended FxDxF motif derived of CCDC32

Browse structure collections

About this viewer

MolViewer shows 9PUE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.