9PX5: Fab 7268

Crystal structure of Fab 7268 in complex with MBP-TREM2 Ig domain fusion. Determined by X-ray diffraction at 3.7 Å resolution. Released 10 Sept 2025.

Method: X-ray diffraction
Resolution: 3.7 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 3
Atoms: 6,597
Mol. weight: 102.15 kDa
Released: 10 Sept 2025

Explore 9PX5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9PX5 contains 39 α-helices and 77 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	-343--340	4	1
α-helix	-332--319	14
β-strand	-315--312	4	1
α-helix	-307--299	9
β-strand	-291--287	5	1
α-helix	-286--284	3
α-helix	-283--278	6
β-strand	-274	1	2
α-helix	-267--264	4
β-strand	-261	1	3
α-helix	-259--254	6
β-strand	-245--239	7	1
β-strand	-236--232	5	4
β-strand	-222	1	5
α-helix	-218--211	8
β-strand	-203	1	4
α-helix	-196--188	9
β-strand	-183--178	6	6
β-strand	-175--168	8	6
α-helix	-164--150	15
α-helix	-140--132	9
β-strand	-126--123	4	4
α-helix	-121--119	3
α-helix	-118--113	6
β-strand	-108--105	4	4
α-helix	-104--102	3
β-strand	-101	1	5
β-strand	-100	1	7
β-strand	-97	1	7
α-helix	-96--95	2
α-helix	-93--92	2
β-strand	-91	1	8
β-strand	-90--84	7	1
β-strand	-83	1	2
α-helix	-77--71	7
α-helix	-70--66	5
α-helix	-63--54	10
β-strand	-49--48	2	1
β-strand	-46	1	3
α-helix	-45--39	7
α-helix	-35--24	12
β-strand	-21	1	8
α-helix	-20--19	2
α-helix	-14-2	17
α-helix	7-18	12
β-strand	23-27	5	9
β-strand	32-37	6	10
β-strand	47-53	7	11
β-strand	60-65	6	11
β-strand	82-87	6	10
β-strand	92-97	6	10
β-strand	108-114	7	11
β-strand	117-124	8	11
β-strand	125-129	5	9

Chain H: 9 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	12
β-strand	11-12	2	13
β-strand	18-25	8	12
β-strand	34-39	6	14
β-strand	46-51	6	14
β-strand	57-59	3	14
β-strand	67-72	6	12
α-helix	73-75	3
β-strand	77-82	6	12
α-helix	87-89	3
β-strand	91-98	8	14
β-strand	110-113	4	14
β-strand	117-119	3	14
β-strand	120-121	2	13
α-helix	124-126	3
β-strand	127	1	15
α-helix	128-129	2
β-strand	130-134	5	16
α-helix	138-140	3
β-strand	141-142	2	16
β-strand	145-155	11	16
β-strand	156	1	15
β-strand	161-164	4	17
α-helix	165-167	3
β-strand	173-175	3	16
α-helix	176-178	3
β-strand	179-180	2	16
β-strand	186-195	10	16
α-helix	196-198	3
β-strand	199	1	18
β-strand	202	1	18
β-strand	205-210	6	17
α-helix	211-213	3
β-strand	215-220	6	17

Chain L: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	19
β-strand	10-13	4	20
β-strand	19-25	7	19
β-strand	33-38	6	20
β-strand	45-49	5	20
β-strand	53-54	2	20
α-helix	55	1
β-strand	62-67	6	19
β-strand	70-75	6	19
α-helix	80-82	3
β-strand	85-90	6	20
β-strand	98	1	20
β-strand	102-106	5	20
β-strand	111	1	21
α-helix	112-113	2
β-strand	114A-118A	5	22
α-helix	119A-121A	3
α-helix	122A-125A	4
β-strand	129-139	11	22
β-strand	140	1	21
β-strand	145-150	6	23
β-strand	153-154	2	23
α-helix	155	1
β-strand	159-163	5	22
β-strand	173-182	10	22
α-helix	183-188	6
β-strand	191-197	7	23
β-strand	205-210	6	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose/maltodextrin-binding periplasmic protein,Triggering receptor expressed on myeloid cells 2	A	protein	492	Escherichia coli, Homo sapiens	P0AEX9 (AlphaFold model), Q9NZC2 (AlphaFold model)
7268 Fab Heavy Chain	H	protein	226	Homo sapiens
7268 Fab Light Chain	L	protein	214	Homo sapiens

Sequence of entity 1 (A), FASTA

>9PX5_1 Maltose/maltodextrin-binding periplasmic protein,Triggering receptor expressed on myeloid cells 2 (chains A)
KTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDII
FWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKD
LLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIKD
VGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEHAFNHGETAMTINGPWAWSNIDTSAV
NYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLG
AVALKSYEEELVKDPRVAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAA
LAAAQTNAHDTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLW
LLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLA
DPLDHHHHHHHH

Sequence of entity 2 (H), FASTA

>9PX5_2 7268 Fab Heavy Chain (chains H)
QVQLQQWGAGLLKPSETLSLTCAVYGVSFSGYHWYWIRQPPGKGLEWIGEIDNKGQTNYN
PSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARGGSYYGHPYLAAPDIWGQGTMVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC

Sequence of entity 3 (L), FASTA

>9PX5_3 7268 Fab Light Chain (chains L)
DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPYTFGQGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

Building a potent TREM2 agonistic, biparatopic, common light chain antibody. da Silva Almeida, A., Geddie, M.L., Bhate, A. et al. MAbs (2025) 17:2546554-2546554. DOI 10.1080/19420862.2025.2546554 · PubMed

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8C8F 1.15 Å, Crystal structure of the E. coli maltodextrin-binding protein
4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
5M13 1.37 Å, Synthetic nanobody in complex with MBP
5HZ7 1.43 Å, High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria…
5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan

Browse structure collections

About this viewer

MolViewer shows 9PX5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.