9Q0Z: Telomerase reverse transcriptase

Human telomerase catalytic core with shelterin protein TPP1, BIBR1532 and DNA primer ending in AGGG. Determined by electron microscopy at 3.1 Å resolution. Released 17 Jun 2026.

Method: Electron microscopy
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 6
Atoms: 14,706
Mol. weight: 327.86 kDa
Ligands: 55C
Released: 17 Jun 2026

Explore 9Q0Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9Q0Z contains 72 α-helices and 53 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 53 helices, 41 β-strands

Element	Residues	Length	Sheet
α-helix	8-17	10
β-strand	20-23	4	1
α-helix	24-31	8
α-helix	45-53	9
β-strand	54-58	5	1
α-helix	77-91	15
β-strand	101-103	3	2
β-strand	119-121	3	2
α-helix	126-132	7
α-helix	135-144	10
α-helix	146-155	10
β-strand	157-162	6	1
β-strand	166-171	6	1
α-helix	175-177	3
β-strand	325-327	3	3
α-helix	328-331	4
β-strand	332	1	4
α-helix	346-349	4
α-helix	354-364	11
α-helix	372-374	3
α-helix	379-383	5
α-helix	384-387	4
α-helix	390-400	11
α-helix	405-412	8
α-helix	445-451	7
α-helix	455	1
β-strand	456	1	4
α-helix	457	1
α-helix	458-472	15
α-helix	475-478	4
α-helix	481-495	15
β-strand	502-504	3	3
α-helix	505-508	4
α-helix	518-520	3
α-helix	531-547	17
α-helix	548-553	6
α-helix	554-558	5
β-strand	561-565	5	4
β-strand	573-577	5	4
α-helix	578-596	19
β-strand	598-600	3	5
α-helix	601-602	2
α-helix	603-610	8
β-strand	617-626	10	5
β-strand	629-636	8	5
α-helix	655-671	17
α-helix	673-676	4
β-strand	679	1	6
α-helix	683-697	15
α-helix	704-706	3
β-strand	707-710	4	6
β-strand	712	1	7
β-strand	713	1	8
α-helix	716-719	4
α-helix	722-732	11
β-strand	738	1	9
β-strand	740-751	12	1
β-strand	754-764	11	1
α-helix	773-783	11
β-strand	790-797	8	1
β-strand	801	1	9
α-helix	802-814	13
β-strand	816-820	5	5
β-strand	823-827	5	5
β-strand	833	1	10
β-strand	835	1	10
α-helix	838-850	13
β-strand	862-865	4	6
β-strand	869	1	7
β-strand	870-874	5	6
α-helix	877-888	12
β-strand	891	1	11
α-helix	892-894	3
β-strand	896	1	11
β-strand	898	1	8
α-helix	900-902	3
β-strand	904-905	2	6
α-helix	912-914	3
β-strand	920	1	6
β-strand	927-930	4	12
β-strand	933-936	4	12
β-strand	942-944	3	12
α-helix	946-949	4
α-helix	966-981	16
α-helix	984-987	4
α-helix	994-1016	23
α-helix	1025-1027	3
α-helix	1029-1050	22
β-strand	1058	1	13
β-strand	1062	1	13
α-helix	1067-1081	15
α-helix	1086-1106	21
α-helix	1109-1118	10
α-helix	1127-1129	3

Chain C: 10 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	99-103	5
α-helix	105-107	3
β-strand	113-122	10	16
α-helix	125-127	3
α-helix	135-137	3
β-strand	143-147	5	16
β-strand	152-157	6	16
α-helix	159-164	6
α-helix	168-171	4
α-helix	173-176	4
β-strand	180-192	13	16
α-helix	193-194	2
β-strand	195	1	17
β-strand	198	1	17
α-helix	199-200	2
β-strand	201-215	15	16
β-strand	223	1	16
α-helix	228-238	11

Chain F: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	39-49	11
β-strand	54-55	2	14
α-helix	57-84	28
β-strand	89-90	2	15
α-helix	92-102	11
α-helix	107-123	17

Chain G: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	19-22	4
α-helix	28-37	10
β-strand	43-44	2	15
α-helix	47-73	27
β-strand	78-79	2	14
α-helix	81-89	9
α-helix	92-97	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Telomerase RNA	B	RNA	451	Homo sapiens
Telomerase reverse transcriptase	A	protein	1167	Homo sapiens	O14746 (AlphaFold model)
Telomeric repeat substrate	D	DNA	18	Homo sapiens
Histone H2B type 1-C/E/F/G/I	F	protein	126	Homo sapiens	P62807 (AlphaFold model)
Histone H2A.J	G	protein	129	Homo sapiens	Q9BTM1 (AlphaFold model)
Adrenocortical dysplasia protein homolog	C	protein	163	Homo sapiens	Q96AP0 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>9Q0Z_1 Telomerase RNA (chains B)
GGGUUGCGGAGGGUGGGCCUGGGAGGGGUGGUGGCCAUUUUUUGUCUAACCCUAACUGAG
AAGGGCGUAGGCGCCGUGCUUUUGCUCCCCGCGCGCUGUUUUUCUCGCUGACUUUCAGCG
GGCGGAAAAGCCUCGGCCUGCCGCCUUCCACCGUUCAUUCUAGAGCAAACAAAAAAUGUC
AGCUGCUGGCCCGUUCGCCCCUCCCGGGGACCUGCGGCGGGUCGCCUGCCCAGCCCCCGA
ACCCCGCCUGGAGGCCGCGGUCGGCCCGGGGCUUCUCCGGAGGCACCCACUGCCACCGCG
AAGAGUUGGGCUCUGUCAGCCGCGGGUCUCUCGGGGGCGAGGGCGAGGUUCAGGCCUUUC
AGGCCGCAGGAAGAGGAACGGAGCGAGUCCCCGCGCGCGGCGCGAUUCCCUGAGCUGUGG
GACGUGCACCCAGGACUCGGCUCACACAUGC

Sequence of entity 2 (A), FASTA

>9Q0Z_2 Telomerase reverse transcriptase (chains A)
GHMSAWSHPQFEKGGGSGGGSGGSAWSHPQFEKSAMPRAPRCRAVRSLLRSHYREVLPLA
TFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPWDARPPPAAPSFRQVSCLKELVARVL
QRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVRSYLPNTVTDALRGSGAWGLLLRRVG
DDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPPHASGPRRRLGCERAWNH
SVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGP
SDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVY
AETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQR
YWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDP
RRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSL
QELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVTE
TTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIP
KPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGASVLGLDD
IHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQNTYCVRRYA
VVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGL
FDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLR
LVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNLRKTVVNFPVEDEALGGTAFVQMPAH
GLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKAGRNMRRKLFGVLRLKCHSL
FLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYS
ILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQTQLSR
KLPGTTLTALEAAANPALPSDFKTILD

Sequence of entity 3 (D), FASTA

>9Q0Z_3 Telomeric repeat substrate (chains D)
TTAGGGTTAGGGTTAGGG

Sequence of entity 4 (F), FASTA

>9Q0Z_4 Histone H2B type 1-C/E/F/G/I (chains F)
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK

Sequence of entity 5 (G), FASTA

>9Q0Z_5 Histone H2A.J (chains G)
MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESQKTKSK

Sequence of entity 6 (C), FASTA

>9Q0Z_6 Adrenocortical dysplasia protein homolog (chains C)
GAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLV
SDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQV
DRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSN

Ligands and cofactors

ID	Name	Formula	Copies
55C	2-{[(2E)-3-(naphthalen-2-yl)but-2-enoyl]amino}benzoic acid	C21 H17 N O3	1

Primary citation

Structures of human telomerase with BIBR1532 reveal novel mechanism of inhibition. Wang, Y., Liu, B., He, Y. et al. Nat Chem Biol (2026). DOI 10.1038/s41589-026-02238-6 · PubMed

Other PDB entries of the same protein (UniProt O14746 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MEO 1.77 Å, Human Leukocyte Antigen presenting ILGKFLHRL
5MER 1.88 Å, Human Leukocyte Antigen A02 presenting ILAKFLHEL
5MEQ 2.27 Å, Human Leukocyte Antigen A02 presenting ILAKFLHTL
5UGW 2.31 Å, Structure of the human telomerase thumb domain
4B18 2.52 Å, The crystal structure of human Importin alpha 5 with TERT NLS peptide
9Q16 2.7 Å, Human telomerase catalytic core with shelterin protein TPP1, dGpNHpp and DNA primer…
5MEP 2.71 Å, Human Leukocyte Antigen A02 presenting ILGKFLHWL
4MNQ 2.74 Å, TCR-peptide specificity overrides affinity enhancing TCR-MHC interactions
2BCK 2.8 Å, Crystal Structure of HLA-A*2402 Complexed with a telomerase peptide
9Q12 2.8 Å, Human telomerase catalytic core with shelterin protein TPP1 and DNA primer ending in TTAG
5MEN 2.81 Å, Human Leukocyte Antigen A02 presenting ILAKFLHWL, in complex with cognate T-Cell Receptor
9Q10 2.9 Å, Human telomerase catalytic core with shelterin protein TPP1, dTpNHpp and DNA primer…

Browse structure collections

About this viewer

MolViewer shows 9Q0Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.