9Q3L: Beta-2 adrenergic receptor

CryoEM structure of beta2-adrenergic receptor dimer mediated by a biased allosteric modulator in lipid nanodisc. Determined by electron microscopy at 2.5 Å resolution. Released 19 Aug 2026.

Method: Electron microscopy
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,790
Mol. weight: 106.1 kDa
Ligands: C14, LFA, P0G, A1CNS
Released: 19 Aug 2026

Explore 9Q3L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9Q3L contains 32 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 16 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	32-60	29
α-helix	62-64	3
α-helix	67-81	15
α-helix	82-86	5
α-helix	87-96	10
α-helix	103-135	33
α-helix	147-170	24
β-strand	175	1	1
α-helix	179-186	8
β-strand	195	1	1
α-helix	197-204	8
α-helix	205-209	5
α-helix	210-235	26
α-helix	266-298	33
α-helix	305-317	13
α-helix	318-320	3
α-helix	322-326	5
α-helix	330-340	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-2 adrenergic receptor	A, B	protein	460	Homo sapiens	P07550 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9Q3L_1 Beta-2 adrenergic receptor (chains A, B)
MKTIIALSYIFCLVFADYKDDDDAMGQPGNGSAFLLAPNRSHAPDHDVENLYFQGTQQRD
EVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPF
GAAHILTKTWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNK
ARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYAEETCCDFFTNQAYAIASSIVSFY
VPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSKFCLKEH
KALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRS
PDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGLEVLFQGPYHVEQEKENKLLAEDL
PGTEDFVGHQGTVPSDNIDSQGRNASTNDSLLETSQVAPA

Ligands and cofactors

ID	Name	Formula	Copies
C14	Tetradecane	C14 H30	2
LFA	Eicosane	C20 H42	2
P0G	8-[(1R)-2-{[1,1-dimethyl-2-(2-methylphenyl)ethyl]amino}-1-hydroxyethyl]-5-hydro…	C21 H26 N2 O4	2
A1CNS	6-bromo-N~4~-cyclohexyl-N~2~-(3,4-difluorophenyl)quinazoline-2,4-diamine	C20 H19 Br F2 N4	2

Primary citation

A biased allosteric modulator is a molecular glue for beta 2 AR dimerization. Shen, J., Peddada, T.N., Komolov, K.E. et al. Nature (2026). DOI 10.1038/s41586-026-10892-y · PubMed

Other PDB entries of the same protein (UniProt P07550 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GQ4 1.9 Å, Structural determinants of the nherf interaction with BETA2AR and pdgfr
2RH1 2.4 Å, High resolution crystal structure of human B2-adrenergic G protein-coupled receptor.
6PS2 2.4 Å, XFEL beta2 AR structure by ligand exchange from Timolol to Alprenolol.
9WG6 2.44 Å, D1R-Gs in complexed with Dopamine/LY3154207/BMSA1/UNC9815
9RKF 2.45 Å, Dark structure of beta-2 Adrenergic receptor with photoazolol in Dark state recorded at…
9RKG 2.45 Å, Mixed model refinement of beta-2 Adrenergic receptor with photoazolol in dark state and…
5D5A 2.48 Å, In meso in situ serial X-ray crystallography structure of the Beta2-adrenergic receptor…
6PS3 2.5 Å, XFEL beta2 AR structure by ligand exchange from Timolol to Carvedilol.
9RKH 2.5 Å, Dark structure of beta-2 Adrenergic receptor with photoazolol in Dark state recorded at…
9WG0 2.59 Å, D1R-Gs in complexed with SKF81297/LY3154207/BMSA1/UNC10062
6PS4 2.6 Å, XFEL beta2 AR structure by ligand exchange from Timolol to ICI-118551.
9RKI 2.6 Å, Mixed model refinement of beta-2 Adrenergic receptor with photoazolol in dark state and…

Browse structure collections

About this viewer

MolViewer shows 9Q3L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.